KEGG   Nitrobacter hamburgensis: Nham_2662Help
Entry
Nham_2662         CDS       T00348                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00071  Fatty acid degradation
nha00280  Valine, leucine and isoleucine degradation
nha00281  Geraniol degradation
nha00310  Lysine degradation
nha00360  Phenylalanine metabolism
nha00362  Benzoate degradation
nha00380  Tryptophan metabolism
nha00410  beta-Alanine metabolism
nha00627  Aminobenzoate degradation
nha00640  Propanoate metabolism
nha00650  Butanoate metabolism
nha00903  Limonene and pinene degradation
nha00930  Caprolactam degradation
nha01100  Metabolic pathways
nha01110  Biosynthesis of secondary metabolites
nha01120  Microbial metabolism in diverse environments
nha01130  Biosynthesis of antibiotics
nha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Nham_2662
   00650 Butanoate metabolism
    Nham_2662
  Lipid metabolism
   00071 Fatty acid degradation
    Nham_2662
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nham_2662
   00310 Lysine degradation
    Nham_2662
   00360 Phenylalanine metabolism
    Nham_2662
   00380 Tryptophan metabolism
    Nham_2662
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nham_2662
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nham_2662
   00281 Geraniol degradation
    Nham_2662
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nham_2662
   00627 Aminobenzoate degradation
    Nham_2662
   00930 Caprolactam degradation
    Nham_2662
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Nham_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE63441
JGI: Nham2662
UniProt: Q1QK06
Position
2924481..2925260
Genome map
AA seq 259 aa AA seqDB search
MSTFEHIIVESKGAVGVIRLNRPKMLNALSFAVFREIAAAVGDLEADDGIGCILITGNEK
AFAAGADVKEMQPKGFIDMVNEDFKASGGDRVATCRKPTIAAVSGYALGGGCELAMMCDI
IIASDTAKFGQPEITLGTIPGIGGSQRLTRAVGKAKAMDLCLTGRMMDAAEAERSGLVSR
IVPADKLMDEAMAAAEKIASMSRPVAAMAKSAVNRAFETTLSEGINVERDLFRSTFALDD
RAEGMAAFVEKRKPNNKHR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcgagcacatcattgtcgagagtaagggcgcggtcggcgtcatcaggctg
aaccggcctaaaatgctcaatgcgctgtcgttcgcggtgtttcgcgaaatcgccgccgcg
gtgggcgatctcgaggctgacgacggcatcgggtgcatcctgatcaccggcaacgaaaag
gccttcgccgccggcgccgacgtcaaggagatgcagccgaagggcttcatcgacatggtc
aacgaggacttcaaggcgagcggcggcgaccgcgtcgccacctgccgcaaaccgaccatc
gcggcggtcagcggctatgcgctcggcggcggctgcgaactcgccatgatgtgcgacatc
atcatcgcctccgacaccgcgaaattcggccagccggaaatcacgctcggcaccattccc
ggcatcggcggcagccagcgcctgacccgcgccgtcggcaaggccaaggcgatggacctc
tgcctcaccgggcggatgatggacgccgcagaggcggaacgctccggtctcgtcagccgc
atcgttcccgccgacaagctgatggacgaagcgatggccgcggccgagaagatcgcctcg
atgtcgcgtcccgtcgcggcgatggccaagagcgccgtcaaccgcgccttcgagacgacg
ctgtcggaaggcatcaacgtcgagcgcgacctgttccgttcgaccttcgcgctggacgat
cgcgccgaaggcatggcggcgttcgtcgagaagcgcaagccgaacaacaagcacaggtaa

DBGET integrated database retrieval system