KEGG   Nitrobacter hamburgensis: Nham_2941Help
Entry
Nham_2941         CDS       T00348                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nham_2941
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Nham_2941
Enzymes [BR:nha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Nham_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3229167..3230714
Genome map
AA seq 515 aa AA seqDB search
MTTTRRTVLLQGSAIGAGLIAANMSAVRALAAPKTPPVRRSLQGLAWNDPIVATYRDAVG
IMKQKATNDKFNWVQLANFHGSINTGFRYCPHGDWYFLPWHRAFTAMYERIVRHLTKNDD
FAMPYWDWTANPTMPEVFLPEKTPDGKTNWLCVSEDGKKRTWPATKPMPANIVGPSVLKT
ILNASPYEIFGTSRPAGQNSLDPHWITGGGGVQGTLEASPHNQVHNNIGGWMPTAASPRD
PIFFMHHGNIDRIWALWNLKHANSTDPLWTNMPFKENFLNPDGSFWSPKVSDLYVPEKLG
YSYGFKAPTAAIASAARTMTLERSLNTILAAPTAATINTDKVATAVVENTKSATPDAALA
LKIAVPQAALQGVVRSVPVGSGFETMDFSAAREASTRGSQALAILRNVAITDPSTTTIHI
YLGDEPVPADASTSDPRYVGSFAVLDHGEGGHGAHEGHELPSFVLDLTDALQRVYGSAGT
IPSAIGLQVVVGNETGNGKAGSATPQRVEVVIVSG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacacgacggacggttctcctgcagggcagcgcgatcggcgccggactcatc
gccgcgaacatgtcagcggtgcgcgcgctcgcggcgcccaagacgcctccggtccggcgt
tcgctgcaggggcttgcctggaacgatccgatcgtcgcgacttatcgcgatgcggtcggc
ataatgaagcagaaggcgaccaacgataagttcaactgggtacagctcgcgaattttcac
ggcagcatcaacaccgggtttcgctactgcccgcacggcgactggtacttcctgccctgg
caccgcgcgttcacggcgatgtacgaacgcatcgtccggcatctgacgaagaacgacgac
ttcgccatgccctactgggactggacggcgaatccgacaatgcccgaagtgttcctgcct
gagaagactccggacggaaagaccaactggctgtgcgtgagcgaggacggaaaaaaacgg
acctggccagcgaccaagccgatgccggcgaacatcgtcgggccttcggtgctcaaaacc
attctcaacgcgtcgccgtacgagatcttcggaaccagccggcccgccggacagaattcg
ctcgatccacattggattactggcggcggcggcgtgcaaggcacactcgaagcgtcgccg
cacaaccaggtccacaacaacatcggcggctggatgccaacggccgcatcgccgcgcgat
ccgatattcttcatgcaccacggaaatatcgaccggatatgggcgctgtggaatctcaaa
catgcgaacagcaccgatccgctatggacgaacatgccgtttaaggaaaacttcctcaat
ccggacggatcgttctggtcgccgaaagtgtccgacctctacgttcctgaaaagctcggt
tacagctacgggttcaaggcgccaacggcagcgatcgccagcgccgcccgaacgatgact
ctggagcgttcgctcaacaccatcctcgcagcgccgacggccgccaccatcaataccgac
aaggtcgcgaccgccgtggttgaaaataccaagagcgcgacgccggatgcggcgctggcg
ctcaaaatcgcggtgccgcaggctgccctgcagggcgtcgtgcggagcgttccggtcggc
tcggggttcgaaacgatggatttctccgcggccagggaagcgtcgacacggggaagccag
gcgctggccattcttcgtaatgtcgccatcaccgatccgagcacgacgacgatccacatt
tatctgggcgacgaacctgtcccggccgatgcctcgacgtcggacccccgctacgtcggg
agctttgccgtcctcgatcacggcgagggcggtcatggcgcgcatgagggccacgagctt
ccgtccttcgtcctcgatctcaccgatgcactccagcgcgtctatggttcggccggaacg
atcccgagtgcgatcgggttgcaggtcgtcgtgggcaacgagaccggaaacggcaaggcc
ggtagtgccacgccgcagcgcgttgaggtcgtcatcgtttcggggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system