KEGG   Nitrobacter hamburgensis: Nham_3055Help
Entry
Nham_3055         CDS       T00348                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00521  Streptomycin biosynthesis
nha00523  Polyketide sugar unit biosynthesis
nha01130  Biosynthesis of antibiotics
Module
nha_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Nham_3055
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nham_3055
Enzymes [BR:nha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Nham_3055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABE63801
JGI: Nham3055
UniProt: Q1QIZ6
Position
complement(3371936..3372559)
Genome map
AA seq 207 aa AA seqDB search
MSQLFPSDDRSVLCSDGKGVRRRLEVHCLAIPDVKLIRTPRFSDTRGYFCETFQRADFAA
QGLDCDFLQDNQSSSDRPGTVRGLHFQRPPFAQTKLVRVLRGSILDVAVDLRRSSSSFGR
HVAMELSSESNEQLLVPAGFAHGFCTLEPDTVVFYKVDQVYSAAHDSGVNWADSRLGIEW
PVASAEANLSEKDRGLPMLVDLAPVFE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccagcttttcccttccgacgacaggagtgtgctgtgttccgatggcaagggagtg
cggaggcggctggaggtgcattgtttggcaattcctgatgtcaagctgatcaggacgcca
cgattttccgacacccgaggatatttttgcgagacgttccagcgcgcggactttgctgcg
caaggccttgattgcgattttctccaggacaatcaatcgagctccgatcgaccaggaacc
gttcgtggcctgcactttcaacggccgcctttcgctcagacgaagttggttcgtgtgcta
cgcggcagcattttggatgtggctgtcgatctccgccgctcgtcgtcaagctttgggagg
catgttgcaatggagctgagcagtgagagtaacgagcaactcctcgttccggcaggcttt
gcccatggcttttgcacgctcgagcccgatacggtcgtcttttacaaggtcgatcaggtc
tattcggctgcgcatgacagcggggtcaactgggccgactccagattgggaattgaatgg
cctgttgcttcggcagaggcgaatttgtctgagaaggatcgcgggctgccgatgttggtc
gatcttgccccggttttcgaatag

DBGET integrated database retrieval system