KEGG   Nitrobacter hamburgensis: Nham_3205Help
Entry
Nham_3205         CDS       T00348                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
nha  Nitrobacter hamburgensis
Pathway
nha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nham_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ABE63940
JGI: Nham3205
UniProt: Q1QIK7
Position
3532717..3533118
Genome map
AA seq 133 aa AA seqDB search
MKTFAISALTVLGVALASVGTSSAQDAAAGKAAFNKCKACHDIGEGAKNKVGPELNGLDG
RHSGAVAGYAYSDANKNSGITWNEAEFKEYIKDPKAKVPGTKMSFAGIKKQSELDNLWAY
VSEFDKDGKVKAK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttcgccatctccgcactgactgttctcggcgtcgcgcttgcaagcgtgggc
acctcaagcgcacaggatgcggccgccggaaaggcagccttcaacaagtgcaaggcatgt
catgacatcggcgaaggcgccaagaacaaggtcggaccggagctgaatggcctggatggc
cgccattccggcgccgtggcaggctatgcctattcggacgccaacaagaattccggcatc
acctggaacgaggcagagttcaaggaatacatcaaggaccccaaggccaaggtcccgggc
accaagatgtcgttcgccggcatcaagaagcaaagcgaactcgacaacctctgggcctat
gtctcggagttcgacaaggacggcaaggtcaaggcgaagtaa

DBGET integrated database retrieval system