KEGG   Nitrobacter hamburgensis: Nham_3373Help
Entry
Nham_3373         CDS       T00348                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nha  Nitrobacter hamburgensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nham_3373
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nham_3373
Enzymes [BR:nha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nham_3373
Two-component system [BR:nha02022]
 CheA family
  CheA-CheYBV
   Nham_3373
Bacterial motility proteins [BR:nha02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nham_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3712305..3713450)
Genome map
AA seq 381 aa AA seqDB search
MRTAVASPAALDSGRQEPLRVMVVDDSVVIRGLISRWIEAEPDMVVAASLRTGLDAVNQV
ERANPDVVVLDIEMPELDGISALPQLLAKKRNLIVIMASTLTRRNAEISFKALSLGAADY
IPKPESTREIAAADIFKHDLIQKIRHLAAKRRRPAALASAREPEPRPIQATPVPAHSAPV
LRPFSTHAPRALLIGSSTGGPQALMTLVAGIGPVIDRYPVLITQHMPPTFTTILAEHLAR
AAGRPAHEGVDEEIVKPGHIYLATGGRHMRLARKGTGAVIVLDDGPAVNFCKPAVDPLFT
SAIDVWQGGILAVILTGMGSDGMRGGQQIVAAGGNVIAQDEASSVVWGMPGAAAQAGICA
AVLPLQQIAPKLVRLFAGDHS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactgctgtggcaagtccggcggctctggattcggggaggcaggagccgctgcgt
gtcatggtggtcgatgactccgtcgtcattcgcggactgatttcccgatggatcgaggcc
gagcccgacatggtggtcgcggcctcgctgcgcaccgggctcgacgcggtcaaccaggtc
gagcgcgccaatcccgacgtcgtcgtcctcgatatcgaaatgcccgagctcgacggcatc
tccgcgctgccgcaactactggcaaagaagcgcaatctcattgtcatcatggcctcgacg
ctgacccgccgcaatgcggagatcagtttcaaggccctgtcgctcggcgccgccgattac
attccgaagccggaaagcacccgcgagatcgccgcggccgatatcttcaagcacgacctg
atccagaagatccggcatctcgccgcaaagcgtcgtcgcccggcggcgctcgcctcggcg
cgcgagccggaaccgcgtcccatccaggccactcctgtgccggcgcattcggcaccggtg
ttgcgccccttcagcacgcacgccccgcgcgcgctgctgatcggctcgtccacaggcggg
ccgcaggcgctgatgacgctggtggccggaatagggccggtgatcgaccgctatccggtg
ctgatcacgcagcacatgccgccgacgttcacgaccattctcgccgagcatctggcgcga
gccgccggacgcccggcgcatgagggggtggatgaggagatcgtgaaaccaggtcatatc
tatctcgcgaccggcggccgccacatgcgcctggccagaaagggcacaggcgccgtcatc
gtgctcgatgacggcccggcggtgaatttctgcaaaccggccgtcgatccgctgttcacg
tcggcgatcgacgtctggcagggaggcattctggccgtcatcctgacgggaatgggatcg
gacggaatgcgcggcggccagcaaatcgtcgcggcagggggcaatgtcatcgcgcaggac
gaagcgagcagcgtggtgtggggaatgccgggcgcagccgcccaggccggaatttgcgcg
gccgttttgccgcttcaacagatcgcaccgaagctcgttcggctgtttgcgggagaccat
tcgtga

DBGET integrated database retrieval system