KEGG   Nitrobacter hamburgensis: Nham_3378Help
Entry
Nham_3378         CDS       T00348                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nha  Nitrobacter hamburgensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Nham_3378
Enzymes [BR:nha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Nham_3378
Transfer RNA biogenesis [BR:nha03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Nham_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3718239..3719114
Genome map
AA seq 291 aa AA seqDB search
MLPPQGGRRRSATPCKEAANVPVIDAQSATALMDALTALVAKAGTAVLSVKRDRMTIGGK
ADGSPVTDADLASDRIIAEGLARLCPDIPVLSEERVHLATPPYVGSFFLIDPLDGTKEFI
AGRDEFTVNLAIVTDGVPLFGIVGAPALGSIWRGLVGHGAQRLAVAPDSDVGGAEPIATR
PFPGRGCQWIAAVSRSHGDSRSNAFIDSRPGAVRKPLGSAVKFCRIAEGGADIYPRLAPT
SEWDVAAGHALVAAAGGKITDGRGAPLRFGESREGFLVPEFIAWGDPSAAP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccaccacaaggcggtcgccgccgttctgcgacaccgtgcaaggaagctgcgaac
gtgccggtgatcgacgctcaatccgctacggcgctgatggatgcgctgacggcgctggtc
gcgaaggccggcaccgccgtcctctcggtcaagcgcgatcgcatgacgatcggcggcaag
gccgacggatctccggtcacggacgcggatctcgcctccgaccgcatcatcgccgaaggg
ctcgcgcgactctgccccgatattccggtgctatcggaggagcgcgtgcatctggcgacg
ccgccttatgtcggcagcttcttcctgatcgatccgctggacggcaccaaggaattcatc
gccggccgcgacgaattcacggtcaacctcgcgatcgtgaccgacggcgtgccgcttttc
ggaatcgtcggtgcgccggcgctcggctcgatctggcgcggccttgtcggccacggcgcc
cagcgcctcgcggtcgcgcccgacagcgacgtcggcggcgcggagccaatcgcgacccga
ccgtttcccggccgcggctgccaatggattgccgccgtcagccgttcgcacggcgacagc
cgttcgaacgccttcatcgacagccggcccggcgcggtgcgcaagccgctcggctccgcg
gtcaagttctgccggatcgcggagggcggcgccgacatctatccccgccttgccccgacc
agcgaatgggacgttgcggcaggtcacgctttggtcgccgccgccggcggcaagatcacc
gacgggcggggcgcgccgctgcgtttcggcgaatcgcgcgaaggatttctggtgccggag
tttatcgcctggggcgatccctcggccgcgccttga

DBGET integrated database retrieval system