KEGG   Nitrobacter hamburgensis: Nham_3534Help
Entry
Nham_3534         CDS       T00348                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
nha  Nitrobacter hamburgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_3534
   01230 Biosynthesis of amino acids
    Nham_3534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nham_3534
   00030 Pentose phosphate pathway
    Nham_3534
   00051 Fructose and mannose metabolism
    Nham_3534
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_3534
   00680 Methane metabolism
    Nham_3534
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Nham_3534
Exosome [BR:nha04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nham_3534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3886676..3887707
Genome map
AA seq 343 aa AA seqDB search
MNLADLNTVAQAMVVPGKGILAADESSGTIAKRFDVIGVTSTEESRRDYREMLFRASDAM
TKYISGVILYDETIWQNARDGTPLVKLIEQAGAIPGIKVDEGTQPLPGCPGELVTVGLDK
LAERLKKYYAQGARFAKWRAVIDINAAGGIPSMTAIGVNAHALGRYAALCQAAQIVPIVE
PEVLMDGDHDIERCFDVTSRVLNVTFQELRKQRVALEGMILKPNMAIAGKKSTKKASVEE
VAEKTVRMLKACVPAAVPGIAFLSGGQSDEEATAHLDAMNRIGNLPWKLTFSYGRALQSA
PQKAWSGKAENVVAGQRALTHRAQMNSLATKGEWKADLEKKAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgctgacctcaacacagtggcgcaagccatggtcgtgcccggcaagggcatt
ctcgccgccgacgaatcctccggaaccatcgcaaaacggtttgacgtgatcggtgtgacc
tccaccgaggaaagccgccgcgactaccgcgagatgctatttcgcgccagcgacgccatg
acgaaatacatctccggcgtcattctctacgacgagaccatctggcagaacgccagggac
ggcaccccgctggtcaagctgatcgagcaagcgggcgccattcccggcatcaaggtcgac
gagggcacacaaccgctgcccggatgccccggcgaactcgtgaccgtcggactggacaag
ctcgccgagcgcctgaagaaatactacgctcagggcgcacgcttcgcgaaatggcgcgcg
gtgatcgacatcaacgcggccggcggcatcccgagcatgacggcgatcggcgtcaacgcc
catgcgctggggcgctatgctgcgctgtgccaggccgcccagatcgtgccgatcgtcgag
ccggaagtgctgatggacggcgatcacgacatcgagcgctgctttgatgtcacgtcgcgc
gtgctcaacgtgacgttccaggagttgcggaagcaacgcgtcgcgctggaaggcatgatc
ctgaaaccgaacatggcgatcgcgggcaagaagagcacgaagaaggcctcggtggaggaa
gtggcggaaaagaccgtgcgtatgctgaaagcctgcgtgccggccgccgtccccggcatc
gccttcctgtccggcggacagtccgacgaagaggccaccgcccatctcgacgccatgaac
cggatcggcaacctgccgtggaagctcactttctcctatggccgcgcgctgcagtcggcg
ccgcagaaagcgtggtccggcaaggccgaaaacgtcgtcgccgggcaacgggctctcacc
caccgcgcgcagatgaattcgctcgccaccaagggtgagtggaaagccgatcttgaaaag
aaggctgcgtga

DBGET integrated database retrieval system