KEGG   Nitrobacter hamburgensis: Nham_3617Help
Entry
Nham_3617         CDS       T00348                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nha  Nitrobacter hamburgensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_3617
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nham_3617
   00650 Butanoate metabolism
    Nham_3617
  Energy metabolism
   00190 Oxidative phosphorylation
    Nham_3617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3983386..3983787
Genome map
AA seq 133 aa AA seqDB search
MEPLSGPKSMRTPLSRVRNLGAAHSGTKDFWRQRLTAVAMILLIVPMIVVMMILLGRNQA
GAAQILGSPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDEKTKLASIMANNFFSVTLAL
AAAYAIFKLSSGV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctatccggtccgaagtcgatgcggacaccgctatcgcgggttcgtaacctc
ggcgcagcccattccggaaccaaggacttttggcgacaacgtctgaccgcggtcgccatg
atcttgctcatcgtaccgatgatcgtggtcatgatgatcctgcttggccgcaaccaggcc
ggggcggcgcagattctcggctcgccgccgatcgccatcatcatgctgctgttcgtcgtc
gccagcatctggcatatgaagatcggcatgcaggtgatcatcgaggactacgtgcacgac
gagaaaacgaaactggcgtcgatcatggcgaacaacttcttctccgtcacgttggcgctg
gccgccgcttacgccatcttcaaactgtcatccggagtttag

DBGET integrated database retrieval system