KEGG   Nitrobacter hamburgensis: Nham_3697Help
Entry
Nham_3697         CDS       T00348                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00300  Lysine biosynthesis
nha01100  Metabolic pathways
nha01120  Microbial metabolism in diverse environments
nha01230  Biosynthesis of amino acids
Module
nha_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Nham_3697
Enzymes [BR:nha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Nham_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABE64423
JGI: Nham3697
UniProt: Q1QH74
Position
complement(4069361..4070596)
Genome map
AA seq 411 aa AA seqDB search
MILTFAQEAPPKHYANVGIGPLVATDALSIARDLVRCPSVTPADAGALGVLEKLLGDAGF
EVHRVTFSEPGAADIDNLYARIGATGPHIAFAGHTDVVPPGDESAWTHGAFSGEVKDGFL
YGRGTVDMKGGIACSAAATLEYLEAHGGRPGKDGNGSISFLITGDEEDIAVNGTVKLMQW
AAARGEKFDHCVLGEPSNVAELGDCIKIGRRGSQSGTLYVEGVQGHVAYPHRASNPIPDI
AALITALVSEPLDQGSAQFQPSNLAFTSVDVGNPANNVIPGQARAKFNVRFNDHHNQESL
RALIEARVAKVSGNRIRTRIVWEPSNADVFVTRPGPFTDLVVAAIEEVTGRRPELNTGGG
TSDARFIKDYCPVIEFGLVGQTMHQIDERAPVADLEKLTRIYHGVLDRYFA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgattttaacattcgctcaagaggcgccaccgaaacattatgcgaatgttggaatcgga
ccactggtggccaccgacgctctctccatcgctcgcgacctcgtccgctgcccgtcggtg
acgccggccgacgcaggcgctctcggcgtgcttgagaagctgctcggcgatgccggtttc
gaggttcaccgcgtcaccttcagcgaacccggcgccgccgacatcgacaatctgtatgcc
cgtatcggcgccaccggcccccacatcgcgttcgccggccataccgatgtcgtgcctccc
ggtgacgagtcggcatggacccatggcgcgttttccggcgaggtgaaagacggcttcctc
tacgggcgcggcaccgtggacatgaagggcggcatcgcctgcagcgccgccgccacgctg
gaatatctggaggcgcacggcggtcggccggggaaagacggcaacggctcgatctcgttt
ctgatcaccggcgacgaggaagacatcgccgtcaatggcaccgtcaagctgatgcaatgg
gcggccgcgcgcggtgaaaaattcgatcactgcgtgctcggcgagcccagcaatgttgcc
gaactcggcgactgcatcaagatcggccgccgtggctcgcagtccggcacgctgtatgtc
gagggcgtgcagggccacgtcgcttatccgcaccgcgcgtcaaatccgattccggacatc
gccgcgctgatcaccgcgctcgtcagcgagccgttggatcagggcagcgcgcagttccag
ccgtcgaatctggcgttcacctccgtcgatgtcggcaatcctgcgaacaatgtgattccc
ggacaggcgcgggcgaaattcaacgtccgcttcaacgatcatcataatcaggaatcgctc
cgtgcgctgatcgaagcgcgtgtcgccaaggtctcgggcaatcgcattcggacccggatc
gtgtgggagccctcgaatgccgatgtgttcgtgaccagaccgggcccgttcaccgatctc
gtggtcgcggcgatcgaggaggtgaccggccgcagaccggagctgaacaccggcggcggc
acgtcggatgcgcgtttcatcaaggactactgcccggtgatcgaattcggcctggtcgga
cagaccatgcaccagatcgacgagcgcgcgccggtagccgatctcgaaaagctgacccgt
atctaccacggcgtactggatcgctatttcgcatga

DBGET integrated database retrieval system