KEGG   Nitrobacter hamburgensis: Nham_4360Help
Entry
Nham_4360         CDS       T00348                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nha  Nitrobacter hamburgensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Nham_4360
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nham_4360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:6759..7466
Genome map
AA seq 235 aa AA seqDB search
MSKFGILVLLAIAFLSPALAEQGNAARGRKDFKACAPCHSLEPGRNMTGPSLADLWGRKA
GGVLSFDRYSDALKASGIVWNDDTLDQWLTDPQNVVPGNEMPFDGIKDVGARADLLAFLK
EATKPGAAPARTAQSQMKGMSGMMDGGGHDPNLKSLEPARQVKTITYCRDTYRVTTADGK
MRAFWERNLRFMTDTSKDGPEKNAPAIMPAGMMGDRAAIIFAEPEEIGRFIEPHC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattcggaatcttggtgctgctcgctatcgcatttctgtcgccggctctcgcc
gagcagggtaacgctgcgcgtggtcggaaggatttcaaagcttgcgcgccatgtcattct
cttgaacccggccgcaatatgacggggcccagtttggccgatctctgggggcggaaagcc
ggtggggtattgagcttcgaccgctactccgacgcgctgaaggcgtccgggattgtctgg
aatgatgacacgctcgatcaatggctgaccgatccgcagaacgtggtgccgggtaatgag
atgccgttcgacggcatcaaggatgttggcgcccgcgcagacctgctggcgttcctcaag
gaggctacgaagcccggagccgcacccgcgcggaccgcacaaagccagatgaagggcatg
agcggcatgatggacggcggcggccatgaccctaatctgaaaagccttgagcccgccaga
caggtcaaaacgattacctattgccgcgacacctatcgcgtcactaccgccgacggcaag
atgcgcgcgttctgggaacgcaacctccgcttcatgacggacacaagcaaggatggaccg
gagaaaaatgcgcccgcgattatgcctgcgggaatgatgggtgatcgtgccgcgataatc
tttgccgaaccggaagagatcggcaggtttatcgagccgcattgctag

DBGET integrated database retrieval system