KEGG   Nectria haematococca: NECHADRAFT_101260Help
Entry
NECHADRAFT_101260 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
nhe  Nectria haematococca
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NECHADRAFT_101260
Exosome [BR:nhe04147]
 Exosomal proteins
  Proteins found in most exosomes
   NECHADRAFT_101260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1690 aa AA seqDB search
MAPLPIKFQEVVQLANVGVDTQSIGFNSCTLESDSYVCVREKKSEAAQPEVVIVELKNGN
NVTRRPIKADSAIMHWNRQVIALKAQSRTLQIFDLEQKKKLKSCTMNEDVQFWKWISENE
LGLVTTSSVYHWNVYDAGQDAPVKVFERNANLNVLTVTLQGCQIINYRVNSDGKWMVVVG
ISSQQGRVVGAMQLYSKDRGISQAIEGHAAAFGTLRLEGAPQDTKLFSFAVRTATGAKLH
IVEVDHAESNPVFQKKAVDMFFPPEATSDFPVALQISQKYGVVYMVTKYGFIHLYDLETA
SCIFMNRISSETIFTTCTDNDSSGIVGINRKGQVLFVTIDDTNVIPYLLQNPANTEMAIK
MASRAGLPGADNLYARQFEQLFNSGNYLEAAKIAANSPRGFLRTAETIEKFKRLPAQPGQ
MAYTLQYFGMLLDKGALNRHETIELAQPVLQQNRKHLLEKWLKEGKLDCSEQLGDMVRPY
DVGMALTIYLKADVPQKVVAGFAETGQFDKILPYSAQTGYQPDYIQLLQHITRVNPEKGA
EFASALANSEQGPLVDFERVCDIFQGQGLIQQATAFLLDALKENKPEHARLQTRLLEMNL
MHAPQVAEAILGNEMFTHFDKSRIAQLCEQANLPQKALELYEDPESIKRVIVNIPGSPNF
NPEWLTTFFGKLSVEQSLDCLDAMMKSNIRQNLQSVVTIATKYSDLLGAVRLIDLFEKYK
TAEGLFYYLGSVVNLSEDPDVHFKYIEAATKMGQFNEVERLCRDSNVYNPEKVKNFLKEA
KLPEQLPLIIVCDRFNFVHDLILYLYQNQQFQAIESYVQRVNPGRTPEVIGGLLDVDCDE
NIIKQLLTTVNAQSISIDQLVSEVETRNRLKLLLPFLEATLQAGNTQQAVFNALAKIYID
SNNNPEKFLKENDQYDTLTVGKYCEKRDPNLAYIAYSKGQNDLELVNITNENSMYRAQAR
YLLERSDNQLWGFVLSENNIHRRSVVDQVTATAVPEANDPAKVSVAVSAFLENDLPLELI
ELLEKIVLEPSPFSDNENLQNLLLFTAAKADKARVMDYIHKLDNYNADDIAASCIEVGLF
EEAFEIYKKADNKSAAVDVLIDNVVSIDRAQAYGEEVDLPEVWSKVAKAQLDGLRVADGI
ESYIKAEDPRNYLEVIEIATHAGKNEELVKYLRMTRKTLREPAIDTALAFCYARLDQLSE
LEDFLRGTNVANIEESGDKAYEEGLYEASKIFYTSISNWAKLATTLVHLSDYQAAVECAR
KANNIKVWKQVHEACVEKKEFRLAQICGLNLIVDAEQLQTLVKEYERNGYFDELISLLEQ
GLGLERAHMGMFTELGIALSKYHPDRLMEHIKIFWSRMNMPKMIKACEEANLWPELVFCY
YHYDEFDNAALAVIERPENSWDHQQFKEIVVKVANLEIYYRAIKFYVEQHPSLLTDLLAT
LTPRIDVNRVVKIFQKNDDLPLIKPFLLNVQTQNKRVVNEAVNDLLIEEEDYKTLRDSVQ
NYDNYDATELANRLEKHDLIFFRQIAASIYRKNKRWEKSIALSKQDKLYKDAIETAALSA
KIDIVSDLVQYFVDIGHRECYTGMLYACNELIRPDLVLELSWRHGLMDFSMPYMINLLCQ
QTKELATLKADNEARKTKEKEQEKTEDNTPILGASRLMITAGPTGMGSSPSPAPYGQANG
FAPQPTGYGY
NT seq 5073 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccttcccatcaagttccaggaggttgtccagctcgccaacgtgggcgtggac
acccagagcatcggcttcaactcctgcacactcgagtccgactcgtacgtttgcgtgcga
gaaaagaagagcgaggccgcccaacccgaagttgttattgtcgagctcaagaatggtaac
aacgttactcgtcggccgatcaaggccgacagtgccatcatgcactggaaccgacaagtc
attgccctcaaggctcagtctaggacactccagatctttgatctcgagcagaagaagaag
ctcaagtcgtgtaccatgaacgaggatgttcagttctggaagtggatcagcgagaacgag
cttggtctcgtcacaacgtccagcgtctatcactggaacgtctatgacgctggccaggac
gctcccgtcaaggtctttgagcgtaatgccaacctcaacgttctgaccgtgacattacag
ggctgccaaatcatcaactaccgagtcaacagcgacggcaagtggatggtcgtcgttggt
atttcatcccagcaaggccgcgtggtcggtgccatgcaactctactctaaggaccgagga
atcagccaggccatcgagggtcacgctgctgcctttggcaccctgcgattggagggtgct
cctcaagataccaagcttttcagttttgctgttcgaacagcaactggcgccaagctgcac
atcgtcgaggtcgatcacgccgagtcgaaccccgtcttccagaagaaggctgtcgacatg
ttcttccccccggaagccaccagcgatttccccgtcgcccttcagatttcccagaagtac
ggtgtcgtctacatggtcaccaagtacggctttatccacctttacgaccttgagactgct
tcatgcatcttcatgaaccgaatctcgagcgagaccatcttcacaacatgcaccgacaac
gactcatcgggcatcgtcggtatcaaccgaaagggtcaagtcctcttcgttaccatcgac
gacacgaacgtcatcccttacctcctccagaaccctgccaacaccgagatggccatcaag
atggcttcaagagctggtcttcctggcgccgataacctctatgctcgccagttcgagcag
ctcttcaactctggcaactacttggaggctgccaagattgctgccaactcgccccgaggc
ttcctgcgaaccgccgagacgatagagaagttcaagcgtctgcctgctcagcctggtcag
atggcctacacccttcaatactttggaatgcttctcgacaagggtgccctgaacagacat
gagactattgagctggcacagcctgttctccagcagaaccgcaagcacctgctcgagaag
tggctgaaggagggcaagctggactgctctgagcagctcggtgatatggttcgcccctac
gatgttggcatggccctcaccatttacctgaaggccgatgttccccagaaggttgttgct
ggtttcgctgagactggccaattcgacaagattctcccttactcggctcagactggctac
cagcctgattacatccagctccttcagcacatcacccgcgtcaaccccgagaagggtgcc
gagttcgccagcgctttggccaacagcgagcaaggtcccttggtcgactttgagcgtgtg
tgtgacatcttccagggtcagggtctgatccagcaagccactgccttcctgcttgatgct
ctcaaggagaacaagcctgagcatgctcgcctccagactcgccttctggagatgaacctc
atgcatgctcctcaggttgctgaggccatcctgggcaacgagatgttcacccatttcgac
aagtcccgcattgcccagctctgcgagcaggccaacctcccccagaaggctctcgagctc
tacgaggatcccgagtctatcaagcgggtcattgtcaacattcctggttctcccaacttt
aacccagaatggctgaccaccttttttggcaagctctctgttgagcaatctctggactgc
ctggacgccatgatgaagagcaacatccgccagaacctgcagtctgttgtgaccatcgca
actaagtattccgatcttctcggggccgttcgtctgatcgacctctttgagaagtacaag
accgctgagggtctcttctactaccttggtagcgtcgtgaatctgtcagaagaccccgat
gtgcacttcaagtacatcgaggctgccactaagatgggccagttcaacgaggtcgagcgg
ttgtgtcgcgatagcaacgtgtacaaccctgagaaggtgaagaacttcctcaaggaggcc
aagctccccgagcagcttcctctcatcattgtctgtgaccgcttcaacttcgtccatgac
ctgattctgtacctctatcagaaccaacagttccaggccattgagtcgtatgttcagcgt
gtcaaccctggtcgaactcccgaggttattggcggtttgttggatgtcgactgtgacgag
aacattatcaagcagctgttgactacggttaatgcccagtcaatcagcattgatcagttg
gtttccgaggtcgagacacgaaaccgactcaagcttctgttgcccttccttgaggctacc
ctccaggctggcaacacgcagcaggccgtgttcaacgctcttgccaagatctacatcgac
tccaacaacaaccccgaaaagttcctcaaggagaacgaccagtacgataccctcactgtt
ggaaagtactgcgagaagcgagaccccaacctggcctacattgcctactctaagggccag
aatgatctggagctcgtcaacatcaccaacgagaactccatgtatagggctcaggctcga
tacctgcttgagcgttctgacaaccagctttggggctttgtgctgagcgagaacaacatc
caccgccgttccgtcgtcgaccaggtcactgccacggctgttcccgaggccaacgaccct
gccaaggtgtccgtggctgtgtctgccttccttgagaacgatcttccccttgagcttatt
gagcttctcgagaagattgttctggagccctcacctttcagtgacaatgagaaccttcag
aacctgcttctgttcactgctgctaaggctgataaggctcgtgtgatggactacatccac
aagctcgacaactataatgccgacgatattgccgcctcgtgcattgaggttggtctcttc
gaggaggcttttgagatctacaagaaggccgacaacaagtctgctgccgtcgatgtccta
attgacaacgtcgtcagcattgaccgtgcccaggcttatggtgaggaggttgacctgccc
gaggtttggagcaaggttgccaaggcccagcttgatggtcttcgagtcgccgacggtatc
gagtcttacatcaaggctgaggaccccaggaactaccttgaggtcattgagattgccact
cacgctggcaagaacgaggagctcgtcaagtatctccgcatgactcgcaagactctccgt
gagcctgccatcgacacagctcttgctttctgctatgcccgccttgaccagctcagcgag
ctcgaggacttcctccgaggcaccaacgtcgcgaacatcgaggagtctggagacaaggct
tatgaggagggtctctacgaggcatccaagatcttctacactagcatttccaactgggcc
aagctggccacaaccctggtccatctcagcgactaccaggctgctgttgagtgcgcccgc
aaggccaacaacatcaaggtgtggaagcaggtgcacgaggcttgtgtggagaagaaggag
ttccgattggctcagatctgcggtctcaacctgattgtcgacgctgagcagctccagact
ctggttaaggagtacgagcgcaacggctacttcgatgagctcattagccttctcgagcag
ggccttggccttgagcgtgctcacatgggcatgttcaccgagctgggtattgctctctcc
aagtaccaccccgaccgcctcatggagcacatcaagatcttctggtctcgtatgaacatg
ccaaagatgatcaaggcctgtgaggaggcaaacctctggcctgagctggtcttctgttac
taccattacgacgagtttgacaacgccgctcttgctgtcattgagcgacccgagaactct
tgggaccaccagcagttcaaggagatcgtcgtcaaggttgccaacctggagatctactac
cgcgctatcaagttttacgtggagcagcacccctctctgctcaccgatctcctggccacc
ctcactcctcgcatcgatgtcaaccgtgttgtcaagatcttccagaagaacgatgacctt
cctctcattaagcctttcctactcaacgtgcagacacaaaacaagcgtgtggtgaacgag
gctgtcaacgaccttctcatcgaggaggaggattacaagactcttcgcgactctgtccag
aactacgacaactacgatgccactgagctggccaaccgtctggagaagcacgacctgatc
ttcttccgccagattgctgccagcatctatcgcaagaacaagcgctgggagaagtcgatt
gctctgtccaagcaggacaagctgtacaaggatgccatcgagactgctgctttgtccgcc
aagatcgatattgtcagcgacctcgttcaatactttgtcgacattggccaccgcgaatgc
tacactggcatgctctacgcctgcaatgagctcatccgacctgacctcgtccttgagctc
tcatggcgccacggcctcatggacttctccatgccttacatgatcaaccttctctgtcaa
cagaccaaggagcttgccactctcaaggctgacaacgaggcccgcaagaccaaggagaag
gagcaggagaagacggaagacaacacccccatcctgggcgcttctcgactcatgatcact
gctggccctaccggcatgggctccagcccctcgcctgcgccttacggtcaagccaacggc
ttcgcaccgcagcccaccggctacggctactag

DBGET integrated database retrieval system