KEGG   Nectria haematococca: NECHADRAFT_101961Help
Entry
NECHADRAFT_101961 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
nhe  Nectria haematococca
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NECHADRAFT_101961
  Replication and repair
   03420 Nucleotide excision repair
    NECHADRAFT_101961
Transcription machinery [BR:nhe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NECHADRAFT_101961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 347 aa AA seqDB search
MATEDERYRQSSQYRLWSFTPSNLQELRAKTNSLAREQIAPRLSADPPPDFLTAEEEVRL
VKFFTVELIRAAQFCELPTEIRATAAIFLRRFYVTNSVMTYPAPELLKTSLFFGCKAEGF
FYKLNAFSEKFPNTTGEQILAGEFLLCQGIRFAFDVRHPFRALEGAILELRRKVPDEESR
INRVHARAREILKFSPLVTDAYFHYTPSQIMMAAVSMVDRGLLDVLIPLPNGETGQAAVL
ASMRDKILGAIQSCREMLEEEPPERMTDYWGTPEIVKAMKPLRKKLQKCRDPDRANLVNL
QRARREQAMNKEKKTAANNDGSVFGDDLVRETKRVKLENADPFGPPL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaagacgagcgctaccggcaatcaagccagtatcggctctggtccttcacc
ccgtcaaatctccaagagctgcgcgcaaagacaaactcgctagcaagagagcagatcgcg
ccgcgactctctgccgaccctcctcccgactttctcacggccgaggaagaggtccgcctc
gtcaagttcttcaccgtcgagctcatccgcgccgcccagttctgcgaactccccaccgag
atccgagcgaccgccgccatcttcctgcgacgattctacgtgaccaactcggtcatgaca
tacccggctcccgagctcctcaagacgtcgctgttctttgggtgcaaggctgagggcttc
ttttacaagctgaatgccttttcggaaaaatttcccaatacaactggggagcagatcctg
gctggagagtttctgctttgtcaggggattcgattcgcctttgacgttaggcacccgttc
agagccctcgagggtgcgattttggagttgcggaggaaggtgcctgatgaagagtcacgg
atcaacagagtacacgctcgcgcgcgagagattctcaagtttagtccgttggtcacagat
gcctacttccactacactcccagccagattatgatggcggcagtgtctatggtggaccgt
gggcttctggatgtcttgattcctttgccgaatggtgagacaggccaggctgctgtgttg
gcaagcatgcgcgacaagatcttgggggcgattcagagctgtcgtgagatgctcgaggag
gagcccccagagagaatgacggattattggggaacgcccgaaattgtcaaagcaatgaag
cctctccgaaagaagctgcagaaatgtcgagaccccgatcgagcgaacctggtcaatctt
caacgagcgagacgagaacaagctatgaataaggaaaagaagacggcggcgaacaatgac
ggttctgtgtttggagacgacctcgtgagggagacgaagcgggtgaagctggagaatgcg
gatccctttggcccgcctctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system