KEGG   Nectria haematococca: NECHADRAFT_103427Help
Entry
NECHADRAFT_103427 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
nhe  Nectria haematococca
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NECHADRAFT_103427
   03420 Nucleotide excision repair
    NECHADRAFT_103427
   03430 Mismatch repair
    NECHADRAFT_103427
   03440 Homologous recombination
    NECHADRAFT_103427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 274 aa AA seqDB search
MTRAVSLLEAHSRAARAAVAARYDGITHDSPTASDDLSLQSYQDESLRPVTIKQILDAEE
AFQGADFKIDGSLITQITFVGQIRSVTPQPTNITFKIDDGTGQIEVKKWVDADNNNEPEF
ELDSHVRVWGRLKSFNSKRHVGAHVIRPVEDFNEVSYHMLEATYVHLYFTKGPLGGQGPA
NGEGDSMFVDGGGYNDQAGGNAAPSKLSGCSGLAKKMFSFMNDAPGGNEGVHINGITSST
GLSVRDVLTAADELLGQGLIYTTVDDETWAILEY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgactcgggcggtttctttgctggaggctcacagcagggcagccagggcggcggtggcg
gcaaggtacgatggcatcactcacgattcacccacagcttctgacgatctgtctctacag
tcataccaagatgaatctttgcgtcccgtcacaataaagcagatcctcgacgccgaggag
gccttccagggcgccgacttcaagatcgacggctccctcatcacccagatcacattcgtc
ggccagatccgcagcgtgacgccccagcccacaaacattaccttcaagatcgacgacggc
accggccagatcgaggtcaagaagtgggtcgacgccgacaacaacaacgaaccggagttt
gagctcgactctcacgttcgtgtctggggacgcctcaagtccttcaacagcaagcggcat
gtcggcgcccacgtcatcagacccgtcgaggacttcaacgaggtcagctatcacatgctc
gaggccacatacgttcacctttactttaccaagggtcctcttggtggtcagggaccagcc
aacggtgaaggagacagcatgtttgtcgacggtggcggctacaacgaccaggctggtgga
aatgcagcaccttcgaaactgtccggatgctctggtctagccaagaagatgtttagcttt
atgaacgacgctcctggcggcaacgagggtgttcacatcaacggtattaccagttctacc
ggcctgtcagtgagagacgttctcactgctgcggacgagctgctcggccagggtctcatt
tacacaacggtcgatgacgagacatgggcaatcctcgagtactag

DBGET integrated database retrieval system