KEGG   Nectria haematococca: NECHADRAFT_103501Help
Entry
NECHADRAFT_103501 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
nhe  Nectria haematococca
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nhe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nhe00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 2238 aa AA seqDB search
MSITSLPPASARQVGSEDDGLVCLELEDGSSFQGYSFGAKKSIAGELVFQTGMVGYPESV
TDPSYRGQILVITFPLVGNYGVPSRETMDELLGDLPAHFESSQIHIAGLVTASYCGEDFS
HFLAESSLGTWLKEQGVPAMYGVDTRALTKKIREKGSMLGKMRLEAPGLANGALNGQVDA
PLAATPLEHFEQIDWVNPNTKNLVAEVSIKAPKLYKPPPSVARKHPSGRTIRVLCLDVGM
KYNQLRCFLKRGVEVLVCPWDYDIASAIDEYDGLFLSNGPGDPAVLENTIKNIATVLENN
KIPVFGICLGHQLLARASGARTTKMKFGNRGHNIPCTSMVTGKCHITSQNHGFAVDAASL
TNGWKELFVNANDGSNEGIMHAEKPYFSVQFHPESTPGPRDTEFLFDVFINTIANCAENP
ALLQAPVSFPGGTIEENERLHPRVSVRKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEG
IYTVLINPNIATIQTSKGLADKVYFLPVNADFVRKVIQYERPDAIYVTFGGQTALQVGIQ
LKDEFEGLGVKVLGTPIDTIITTEDRELFARSMDSIGEKCAKSASASNIDEAMHVVKDIG
FPVIVRAAYALGGLGSGFANNEDELLDLCNKAFAASPQVLIERSMKGWKEIEYEVVRDAQ
DNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQY
ALNPFSREYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLKEISNSVTKVTCAC
FEPSLDYVVVKMPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRSFEEAIQKAIRAIDFHNL
GFGETKALMSIDDELQTPSDQRLFAIANAMHEGYTVDKIWELTKIDKWFLRKLKGLSDFA
KKMTSYSTTDIATSPSILLQAKRLGFCDRQLAKFWSSNEIAVRRLRLEAGIQPFVKQIDT
VAAEFPAFTNYLYMTYNASEHDVNFEDHGVMVLGSGVYRIGSSVEFDWCSVRAIRTLRAT
GFKTIMVNYNPETVSTDYDEADKLYFENINLETVLDIYQLENSSGVLGAMGGQTPNNIAL
PLHRAGVKVLGTSPEMIDNAENRYKFSRMLDRIEVDQPTWKELTSFEEAKAFCDKVSYPV
LVRPSYVLSGAAMNTVYSEKDLETYLAQAAEVSREHPVVITKYIENAKEIEMDAVAKDGK
VIGHFISEHVENAGVHSGDATLILPPQDLEQTTIDRIAEATRKIGAALNVTGPFNIQFIA
KDNDIKVIECNVRASRSFPFVSKVMGVDLIEMATKAIMGQPFEEYPPTDLAPDCVGVKVP
QFSFSRLSGADPVLGVEMASTGEVACFGVDKAEAYLKALMSTGFKIPKKNILLSIGSYKD
KREMLPSIQKLEKIGYKLFATSGTADFLQEHGVQVQYLEVLGKEEDHSSEFSLTQHLAKN
TIDLYINLPSNNKYRRPANYMSKGYQTRRMAVDYQIPLVTNVKNAKILIEAIARHFELEV
SKRDYQTSHRTVVLPGLINIAAFVPGIVSPDSQDLQTVTKASISAGFSMIRVMPLGVDGA
ITDALTLSAAQQNSRRGGYCDYNFSVAATSDNADQISHVTGEVGSLFIPFNHLSGNISKV
AAVTAHFDAWPTHKPIVTDAKLTDLASILLLASLHNRRIHVTSVTNRDDIKLIALSKEKG
LQVTCDVSIYSLYLSRDDYPECERLPTSADQAALWEHMSTIDVFSIGSLPFRLATTLGHK
ADPSMGIADALPLLLTSVAEGRLTVDDIKARLYTNPMEIFELHEQVGTTIEAEIDRPYTV
AAGEFWSPFEGRRMRASVQRVTFQDTTVCLDGEVLPVSPQGKDMSSHIAPPMSPPVKPTV
SISQATESPQARRLSMLGGVKPLNRLRGVDAAVGATLPSPARGAAPVDELAPALHLQPLV
SSSLQQLLSQPSAFKNTHVLSVKSYSRADLHLLFTVAQEMRLGVQREGVLNILRGRVLTT
LFYEPSTRTSASFDAAMQRLGGRTIAVSTSHSSVQKGETLQDTLRTLACYGDAVVLRHPE
ESSVHAAQKYSPVPVINGGNGSKEHPTQAFLDLFTIREELGTVQGLTITFLGDLLYGRPV
HSLVYLLRHYHVQVQLVAPKALALPPKVREQLVASGQLLCESETLTPEIMARSDVLYCTR
VQRERFPSEEEYQRVKNSYRVDNASLKHAKSSMIVMHPLPRNEEVAEEVDFDQRAAYFRQ
MRYGLYCRMALLALVMAE
NT seq 6717 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcacttctctacctccggcttcggctcgccaggtcggctctgaggatgatggc
ctcgtctgcctcgagctcgaggatggctcttccttccagggttacagctttggtgccaag
aagagcattgctggtgagctagtcttccagactggcatggtggggtatcccgagtccgtc
acagatccctcgtacagaggacaaatcctcgtcatcacctttcctctggtcggaaactat
ggtgtcccctctcgagagaccatggatgagctcctcggtgacctgccagctcacttcgag
tcgtcccagatccacattgctggactggtgacagcctcatactgcggcgaggacttttct
cacttccttgctgagtcgtccctcggcacttggctcaaggagcagggcgtccccgccatg
tacggcgtcgacactcgcgcccttaccaagaagatccgtgaaaagggtagcatgctgggc
aagatgcgcctcgaggctcctggccttgccaacggcgccctcaacggccaggtcgatgct
cccctggccgctacccctctcgagcactttgagcagatcgattgggtcaatcctaatacc
aagaacttggtggcagaggtttccatcaaggctcccaagctgtataagcctcctccttcg
gtcgcccgtaagcacccgtcagggcgtactatccgtgtcctgtgtctcgatgtcggtatg
aagtacaaccaactgaggtgcttcctcaagcgtggtgtcgaggttcttgtttgtccctgg
gactacgacattgccagcgccattgacgagtacgacggtcttttcctctccaacggtcct
ggtgaccccgccgtgctcgaaaacaccatcaagaacattgctaccgtgcttgagaacaac
aagattcctgtctttggtatctgcctgggacaccaacttctggcccgcgcctctggtgcc
aggaccaccaagatgaagtttggtaaccgtggtcacaacattccctgcaccagcatggtc
accggaaagtgccacatcacctctcagaaccacggtttcgccgtcgatgctgccagcttg
accaatggctggaaggagctctttgtcaacgccaacgatggcagcaatgagggtatcatg
cacgctgagaagccctacttcagtgttcagttccaccctgagagcactcctggtcctcgc
gataccgagttcctcttcgacgtcttcattaacaccattgccaactgcgccgagaaccct
gctcttctccaggctcctgtcagcttccctggtggcaccattgaggagaacgagcgtctt
cacccccgtgtctctgtccgcaaggttcttgttctgggcagtggtggtctcagcattggt
caggctggtgagtttgattactctggttctcaggccatcaaggctctgaaggaggagggc
atctacactgtcctgatcaaccccaacattgccacgattcaaacctccaagggtctggcg
gacaaggtttacttccttcccgtcaatgccgactttgtccgcaaggtcatccagtatgag
cgacctgatgccatctacgtcacatttggtggtcagaccgctctccaggtcggtatccag
ctcaaggatgagtttgagggtctcggtgtcaaggttctgggtactcccattgataccatc
atcacgactgaggatcgtgagctgtttgcccgaagcatggactctatcggcgagaagtgc
gccaagtcggcttctgccagcaacatcgacgaggccatgcacgtcgtcaaggacattggc
ttccctgtcattgttcgtgctgcttatgctcttggtggtcttggcagtggtttcgccaac
aacgaggatgagctcctcgacctctgcaacaaggctttcgccgccagtccccaggttctc
attgagcgcagtatgaagggctggaaggagattgagtatgaggttgtccgtgacgctcag
gacaactgtattaccgtctgtaacatggagaactttgatcctctcggtattcacactggc
gactccatcgttgtcgcgccttcacagactttgtccgacgaggactacaacatgctgaga
acaacagctgtcaacgtcattcggcatctcggcgtcgtgggagagtgcaacattcagtat
gctctgaaccccttctcccgcgagtactgcattatcgaggtcaacgctcgtctctctcga
tcatcggctctcgcctccaaggccaccggttatcctctggcctttatcgctgccaagctc
ggtctcggtattcccctcaaggagatctccaactcggtcaccaaggtcacttgtgcctgc
ttcgagccttcgctcgattacgtcgtggtcaagatgcctcgatgggatctcaagaagttc
acccgtgtgtccactcagcttggttcctccatgaagagtgtgggtgaagtcatgagcatc
ggtcgatcgttcgaggaagctatccagaaggccatccgagctatcgacttccacaacctc
ggctttggcgagaccaaggccttgatgagcattgacgatgagctccagactccctctgat
cagcgtctgtttgctatcgccaacgctatgcacgagggctacactgtcgacaagatctgg
gaactgaccaagatcgacaagtggttcctccgcaagctcaagggtctgagcgactttgcc
aagaagatgaccagctacagcaccaccgacattgctaccagcccgtcaattctgctgcag
gccaagcgtctcggtttctgtgatcgacagctcgccaagttctggagctccaacgagatt
gctgtccgccgcctgagactcgaggctggcatccagcccttcgtcaagcagattgatacc
gttgcggccgagttccctgcctttacaaactacctgtacatgacatacaacgcctcggag
cacgacgtcaactttgaggatcacggtgtcatggtcctgggttctggtgtgtaccgtatc
ggttcctcagtcgagttcgattggtgctcagtccgcgccatccgcactcttcgtgctacc
ggtttcaagaccatcatggtcaactacaaccccgagaccgtaagtaccgattatgacgag
gccgacaagctctactttgagaacatcaacctcgagactgtcctggatatctaccagctg
gagaactcgagcggtgttttgggtgccatgggtggtcagacccccaacaacatcgccctg
cccctccaccgtgccggtgtcaaggtcctgggtacttcccctgagatgattgacaacgcc
gagaaccgatacaagttctctcgtatgcttgaccgcattgaggttgaccagcccacctgg
aaggagcttactagcttcgaggaggccaaggctttctgcgacaaggtctcgtaccctgtg
cttgtgcgaccttcgtacgttctctctggtgccgccatgaacactgtctactccgagaag
gatctcgagacctacttggctcaggctgccgaggtctcccgcgagcaccctgtggtcatc
accaagtacattgagaacgccaaggagattgagatggatgctgtcgccaaggatggcaag
gttattggccacttcatctcggagcatgtcgagaacgccggtgttcactctggtgacgcc
actctgattctccctcctcaggatcttgagcagaccaccatcgaccgcattgccgaggcc
actcgcaagattggtgccgctctcaacgtcactggtcccttcaacatccagttcattgcc
aaggacaatgatatcaaggttattgagtgcaacgtccgcgcctcgcgttcgttccccttt
gtgtccaaggtcatgggtgttgacctgatcgagatggccactaaggctatcatgggccag
cctttcgaggagtatcctcccaccgaccttgcccctgactgcgttggtgtcaaggtgccc
cagttcagtttctcccgtctctctggtgctgatcctgttctgggtgttgagatggcttcc
actggtgaggttgcttgcttcggtgttgacaaggccgaggcttacctcaaggctctcatg
tcgactggcttcaagatccccaagaagaacatcctactgtccattggttcctacaaggac
aagcgtgagatgcttccttcgatccagaagcttgagaagattggctacaagctgtttgcc
acttctggtactgccgatttcctccaggagcatggcgtccaggttcagtacctcgaggtc
ctcggtaaggaggaggaccacagctctgagttctcgctcactcagcatctggccaagaac
accatcgacctgtacatcaaccttccttccaacaacaagtaccgccgccctgccaactac
atgagcaagggttaccagacccgacgtatggctgttgactaccagattcccctggttacc
aacgtcaagaacgccaagatcctcatcgaggccattgctcgtcactttgagcttgaggtg
tccaagcgcgactaccagaccagccaccgcactgttgtgctgcctggacttatcaacatt
gccgcctttgtccctggcattgtttctcctgacagccaggacctccagactgttaccaag
gcttccatctcagccggtttcagcatgatccgagttatgcctctgggtgtggacggcgct
attaccgatgctcttaccctgagcgctgctcagcagaacagccgacgtggtggttattgc
gactacaacttctctgtggccgctacttcagacaacgctgaccagatcagccatgtcacc
ggtgaggtgggatctctcttcatccccttcaaccacctctctggcaacattagcaaggtt
gctgctgtcaccgcccactttgacgcctggcctacacacaagcctatcgtcactgatgcc
aagctgactgatctggcttccatcctcctcctcgccagcctgcacaaccgacgcatccac
gtcacctcggtcactaaccgcgacgacatcaagctcatcgctctcagcaaggagaagggt
ctccaggttacctgcgatgtgtccatctactcgctctacctctctcgggatgactacccc
gagtgcgagcgtctccctacatccgccgaccaggccgccctctgggagcacatgtcgact
attgatgtcttttccatcggcagtctgcccttccgtctggccaccaccctcggccacaag
gctgacccctcgatgggtatcgctgatgctctgcccctgcttctgacctcggtcgctgag
ggtcgcctgactgtcgacgacatcaaggctcgtctctacaccaaccctatggagatcttt
gagcttcacgagcaggttggcaccaccattgaggctgagattgaccgcccttacactgtg
gctgccggcgagttctggtctccttttgagggccgtcgcatgcgcgcttcggttcagcga
gtgaccttccaggacaccaccgtctgccttgatggtgaagttctgcctgtctctcctcaa
ggcaaggacatgtcgtcgcacattgctcctcccatgtctcctcccgtcaagccgaccgtt
tccatctcccaggctaccgagtcgccccaggctcgccgtctgtctatgcttggcggtgtc
aagcccctgaaccgcctccgcggagttgacgccgctgtgggtgctaccctgccctcgccc
gctcgcggtgctgctcctgttgatgagcttgctcctgctctgcacctgcagcctctggtc
agctcttcgctccagcagcttctgtcgcagccttctgccttcaagaacacccacgttctg
tcggtcaagtcatacagccgagctgatctccacctgctcttcactgtggcccaggagatg
cgtcttggtgtgcagcgtgagggtgttctcaacatcctccgaggtcgtgtcctgaccacg
ctcttctacgagccttctacccgcacctcggcttctttcgatgctgctatgcagcgtctt
ggtggtcgtaccatcgccgtctccacctctcactcctctgtccagaagggtgagactctt
caggataccctccgaactctggcttgctacggtgacgccgttgtcctccgtcaccctgag
gagagcagtgtgcatgccgcccagaagtacagccctgtccccgtcatcaacggtggcaac
ggcagcaaggagcaccctacccaggccttccttgatctcttcaccatccgtgaggagctt
ggaactgtccaaggcctgaccatcaccttccttggtgatcttctctacggccgacctgtg
cactctcttgtgtacctgctccgacactaccacgtgcaggttcagctggtcgcccccaag
gctctggccctgccacccaaggtccgagagcagctggtggcttccggacagcttctgtgc
gagtccgagactcttacccctgagatcatggctcgcagcgatgttctctactgcactcgg
gtgcagcgtgagcgcttccccagcgaggaggagtaccagcgtgtcaagaactcttaccga
gtggacaacgcttcgctcaagcatgccaagagctcaatgattgtgatgcaccccctgcct
cgcaacgaagaggttgccgaggaggtcgactttgaccagcgggctgcatacttccgacag
atgcgctatggcctctactgccgcatggctctgttggctctggttatggctgagtaa

DBGET integrated database retrieval system