KEGG   Nectria haematococca: NECHADRAFT_103553Help
Entry
NECHADRAFT_103553 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nhe  Nectria haematococca
Pathway
nhe00920  Sulfur metabolism
nhe01100  Metabolic pathways
nhe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NECHADRAFT_103553
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NECHADRAFT_103553
Transfer RNA biogenesis [BR:nhe03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NECHADRAFT_103553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 9678309
NCBI-ProteinID: XP_003046777
JGI: 103553
UniProt: C7Z5A6
Position
2
AA seq 356 aa AA seqDB search
MAAPAYASELQIAQLAVQRATILTKRVFHEKAKGTVDKNDKSPVTIGDFGAQALIIAALR
HNFPDDAIVAEEEAAQLREDANLKQTIWDLVKDTKLDDEEAEAKLGGPIKDVDDMLELID
RGNSKGGNSGRIWAIDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGVLGCPNLPVDDSARL
TSDIGSNATDEGRGVVFSAVQVHGANSRPLTAGALAPEKSISMRSIDDLAKATFCESVEA
GHSAHDDQALISQKLGITAPSVRMDSQAKYGSIARGAGDIYLRLPVKATYQEKIWDHAAG
DLIVREAGGQVTDIHGKRLDFGVGRTLANNKGVIAAPAAVHDKVLQVVQEVLSAKQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccccgcgtacgcttccgagcttcagattgctcagctggccgtccagcgggct
acgattctcaccaagagggtctttcacgaaaaggcaaagggcaccgtcgacaagaacgac
aagtctcccgtcaccattggcgactttggcgcccaggctctcatcattgctgcccttcgc
cacaactttcccgatgacgccatcgtcgctgaggaggaggctgctcagctgcgtgaggat
gccaacctgaagcagaccatctgggatctcgtcaaggatacaaagctcgatgatgaagag
gcagaggccaagctcggaggccccatcaaggacgtcgacgacatgcttgagctcatcgac
cgaggaaacagcaaggggggcaactctggtcgcatctgggccattgaccctattgatggc
accaagggtttcctccgtggtggacaatacgctgtttgcttgggactcatggttgacggc
gatgtcaaggttggcgtcctcggctgccctaaccttcctgtcgacgactctgctcgtctg
accagcgatatcggctccaatgccaccgacgagggtcgcggtgttgtcttctctgctgtt
caggttcacggcgcaaacagccgacctctgaccgccggtgctcttgcgcccgaaaagtcc
atttccatgcgaagcatcgacgatctcgccaaggctaccttctgcgagagtgtcgaggct
ggccactcggctcatgacgaccaggccctcatctctcagaagctcggcatcactgcgccc
agcgtccgcatggacagccaagccaagtacggctccatcgctcgcggtgctggtgacatt
tacctccgtctgcccgtcaaggccacctaccaagaaaagatctgggaccatgctgctggc
gacctcatcgtccgtgaggccggtggccaggtgacagacattcacggcaagcgtctcgac
tttggcgtcggacgaactctggccaacaacaagggcgtcattgccgcccctgctgctgtg
cacgacaaggttctccaagtagttcaagaggttctgagcgcaaagcagtag

DBGET integrated database retrieval system