KEGG   Nectria haematococca: NECHADRAFT_103648Help
Entry
NECHADRAFT_103648 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nhe  Nectria haematococca
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nhe03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nhe03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 496 aa AA seqDB search
MSVSPAPSLQLAEYLEKLPGTTFRKLYQQPSTAFAIFRRMLPHLAKTFVMRILYSPKPIL
LTDLDDWVKPSAKRQKDQALSILRVLYIVQITAPSKERPQEMQLTANFKTSLRLALSGGG
THNSFGVPSTLQVPPEIDIIFLDRYARRKWEDILHFVVSSVGYKSTGDSSGPNKSVKELL
IAGRLVDRKPNGMVGITQAGFTFLLQEANAQVWTLLLLWLEAMDVNKGAGLEATDMLSFL
FVLASMELGRAYDTNALTEQRKNMLPSLVDFGLIYIPNHKRSMFFPTRLATTLTSSGNSL
RSISDGVAAATAAALQPGQSGGSGGSTTGSGQEQRGSVIIETNYRIYAYTQSTLQIAVLA
LFSKLSMRFPDMVAGRLSRQSIRQAINFGITADQIISYLAAHAHDQMHRTAALNNKPVLP
PTVVDQIRLWQLENERMKTTSGFLFKDFEDHKEYMAVAGFAEEVGVLVWRNDVKGMFFAS
KHEQIRDYLRIRKKAE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcagcccagcgccgtcgctccagctggccgagtacctggagaagctccctggt
accacgttcaggaagctgtaccagcagccctcgacagcctttgccatcttccgccgcatg
ctgccgcatctggcaaaaacatttgtcatgcgcatcctctactctccgaaaccgattctc
ctcacagacctcgacgactgggtcaagccgagcgccaagcgacaaaaggaccaagccctt
tccatcctgcgcgtcctctacatcgtccagatcacggcgccttcgaaagaaaggccgcag
gagatgcagctgactgccaacttcaagacctccctccgactcgccctctccggaggtggc
acccacaactcatttggtgtgccctcgaccctccaggtcccccccgagatcgacatcatc
ttcctcgaccgctacgcaaggaggaaatgggaggatattctacactttgtcgtgtccagt
gtcgggtacaagagcacgggtgacagttccggacctaataagagtgtgaaggaactcctc
atcgcgggccgtctggtcgaccgcaaacccaacggcatggtgggcatcacgcaggctgga
ttcacctttttgctacaagaagccaatgctcaggtctggacgctgcttcttctctggctc
gaggccatggacgttaacaagggcgctggtctcgaagccactgatatgctgtcctttctc
tttgttctcgccagcatggagctaggtcgcgcctacgacacaaacgcgctgaccgagcag
cgtaagaacatgcttccatctcttgtcgactttggcctcatctacatccctaaccataag
cgctccatgttcttcccgactcgtctggcaacgaccctcacatcgagcggcaacagcttg
cgcagcatcagcgacggtgtagctgccgcaacagcagccgccctccagccaggccaatcc
ggtggatctggtggtagcacgacaggttctggccaggagcagcgtggcagcgtcattatc
gagaccaactaccgtatctatgcctatacccagtcgaccctccagatcgctgtcctggcc
ctcttctccaagctctcaatgcgcttcccagacatggtcgccggccgcctctcacgccag
tcaatccgtcaagccattaactttggcatcacggccgatcagatcatctcatacctggct
gcccatgcgcacgaccagatgcaccgcaccgccgccctcaacaataaacccgtcctgcct
ccaacggtcgttgaccagatccgtctatggcagctcgaaaacgagcgcatgaagacaacg
agcggcttcctattcaaggatttcgaggatcacaaggaatacatggccgttgcaggcttt
gccgaggaggtgggcgttttagtctggcgcaacgacgtcaagggcatgttctttgcgagc
aagcacgagcagattcgtgactatcttcgcattcgcaagaaggccgagtag

DBGET integrated database retrieval system