KEGG   Nectria haematococca: NECHADRAFT_103648Help
Entry
NECHADRAFT_103648 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nhe  Nectria haematococca
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NECHADRAFT_103648
  Replication and repair
   03420 Nucleotide excision repair
    NECHADRAFT_103648
Transcription machinery [BR:nhe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NECHADRAFT_103648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 496 aa AA seqDB search
MSVSPAPSLQLAEYLEKLPGTTFRKLYQQPSTAFAIFRRMLPHLAKTFVMRILYSPKPIL
LTDLDDWVKPSAKRQKDQALSILRVLYIVQITAPSKERPQEMQLTANFKTSLRLALSGGG
THNSFGVPSTLQVPPEIDIIFLDRYARRKWEDILHFVVSSVGYKSTGDSSGPNKSVKELL
IAGRLVDRKPNGMVGITQAGFTFLLQEANAQVWTLLLLWLEAMDVNKGAGLEATDMLSFL
FVLASMELGRAYDTNALTEQRKNMLPSLVDFGLIYIPNHKRSMFFPTRLATTLTSSGNSL
RSISDGVAAATAAALQPGQSGGSGGSTTGSGQEQRGSVIIETNYRIYAYTQSTLQIAVLA
LFSKLSMRFPDMVAGRLSRQSIRQAINFGITADQIISYLAAHAHDQMHRTAALNNKPVLP
PTVVDQIRLWQLENERMKTTSGFLFKDFEDHKEYMAVAGFAEEVGVLVWRNDVKGMFFAS
KHEQIRDYLRIRKKAE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcagcccagcgccgtcgctccagctggccgagtacctggagaagctccctggt
accacgttcaggaagctgtaccagcagccctcgacagcctttgccatcttccgccgcatg
ctgccgcatctggcaaaaacatttgtcatgcgcatcctctactctccgaaaccgattctc
ctcacagacctcgacgactgggtcaagccgagcgccaagcgacaaaaggaccaagccctt
tccatcctgcgcgtcctctacatcgtccagatcacggcgccttcgaaagaaaggccgcag
gagatgcagctgactgccaacttcaagacctccctccgactcgccctctccggaggtggc
acccacaactcatttggtgtgccctcgaccctccaggtcccccccgagatcgacatcatc
ttcctcgaccgctacgcaaggaggaaatgggaggatattctacactttgtcgtgtccagt
gtcgggtacaagagcacgggtgacagttccggacctaataagagtgtgaaggaactcctc
atcgcgggccgtctggtcgaccgcaaacccaacggcatggtgggcatcacgcaggctgga
ttcacctttttgctacaagaagccaatgctcaggtctggacgctgcttcttctctggctc
gaggccatggacgttaacaagggcgctggtctcgaagccactgatatgctgtcctttctc
tttgttctcgccagcatggagctaggtcgcgcctacgacacaaacgcgctgaccgagcag
cgtaagaacatgcttccatctcttgtcgactttggcctcatctacatccctaaccataag
cgctccatgttcttcccgactcgtctggcaacgaccctcacatcgagcggcaacagcttg
cgcagcatcagcgacggtgtagctgccgcaacagcagccgccctccagccaggccaatcc
ggtggatctggtggtagcacgacaggttctggccaggagcagcgtggcagcgtcattatc
gagaccaactaccgtatctatgcctatacccagtcgaccctccagatcgctgtcctggcc
ctcttctccaagctctcaatgcgcttcccagacatggtcgccggccgcctctcacgccag
tcaatccgtcaagccattaactttggcatcacggccgatcagatcatctcatacctggct
gcccatgcgcacgaccagatgcaccgcaccgccgccctcaacaataaacccgtcctgcct
ccaacggtcgttgaccagatccgtctatggcagctcgaaaacgagcgcatgaagacaacg
agcggcttcctattcaaggatttcgaggatcacaaggaatacatggccgttgcaggcttt
gccgaggaggtgggcgttttagtctggcgcaacgacgtcaagggcatgttctttgcgagc
aagcacgagcagattcgtgactatcttcgcattcgcaagaaggccgagtag

DBGET integrated database retrieval system