KEGG   Nectria haematococca: NECHADRAFT_103792Help
Entry
NECHADRAFT_103792 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1332 aa AA seqDB search
MALRSEFNGTSAPTADSNGVASRAQPVLNGRPAPNQLPRSDDDDDDQRPSSAPGRRNGNA
VLETRDDIEHHQQQRPSKPLLLRSKSDYARPMDEPEIVKDDIPEWGARHGFEDHYQSEDI
ISDLANNWYMYFTDKRHETTGKPKPLQYELQDWRQRDRLKTVSAALAVCLNIGVEPPDQL
KTSPGAKLEAWTDPTIPPIQKALENIGKALQAQYETLAIRARYKQYLDPSVEETKKFCIS
LRRNAKDERVLLHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQHWLQAPTIFVWDC
SEAGNILNNYHRFVEKHEEEEEEAAERDPNYTKTNFRPYIHLAACAVKENLPTNPLLPAD
LFTACLTTPIEMALWFFVLQNPLKTNLSPDRAKKLPGRLQERRTPLGELNWIFTAITDSI
AWTTLPRDLFRKFFRQDLMVAALFRNFLLAQRVMTVYGCHPQSYPQLPDTHQHPLWETWD
LAVDMALAQLPMLEKKESEGLDYEYQNSTFFTEQLTAFDVYLTRGDAMAQKSPDQLPVVL
QVLLSQQHRVRALILLGRFLDLGPWSVQLALSIGIFPYVLKLLQSAAAELKPVMVFIWAR
LIAVDISCQQDLIKDSGYSYFAQILKPSEGLPVVDSDEHKAMCAFILAMLCKDYKNGQMV
CNQTDIMTYCLTHLQNEENPLLRQWACLCISQLWQDLPEAKWRGIRENAYVKLAYLTKDP
CSYEQLVEEKEYLMYPPQDDGQEHKMGLHYARPEHRNQDGTIKSTSQGLSHNTVYMALWK
LALVLSVDPHPEVQREATIVVDFVHHTLLNSSVGAPAQLVMAEIQKRASRLAHRHTPSAS
QRTSAANAQVTQPLPSPGLLRRTASLLFPSLMNTEDRSRPSTPTTPTPPLPRSPSLKLTH
SPVPPEQNDQSSSFAQYHLAPEPYSGAYQNRNLAKPPTLPLKSRFLEWSIEYFREPQMKP
SEADEPGSTEYNERLWRRARNEAIFRETQPLKQQAGSHKWNNQLGIVNNGAQPAKMTFHQ
FEDHLAVADEGNTVYVWDWKKQGRLSRFSNGNPEGSRISDMKFINEDDQAMLLTGSSDGV
IRVYRNYESDREIELASSWRALTHMVPSNVNSGMVFDWQQVTGRVLVAGDVRVIRVWYAA
YETCIMDIPARSGSCVTSLTSDQMTGHMFVAGFGDGAVRVFDTRNRPQESMVRKWKDESD
RQWIKSVHMQRGGQRELLSASRNGKVKVWDIRMDKPLHSFQTTRDTLRTATTHEHLPVFA
VGTSAHSVKVFNLDGHELSNVEPYSSFLQQSRSSPISATAFHPHRPILGCAAKGDHHINL
FTCEKSEPLSLG
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagatccgaatttaacggcacctctgcgcccaccgccgactccaatggagtc
gcctcgagagcgcaaccggtgctgaatggccgcccagctcccaaccaacttccacgatct
gacgacgacgatgatgaccaacgaccctcaagcgcgccaggtcgacgcaacggaaacgcg
gttctcgaaacacgagatgacattgagcatcaccagcaacagcggccttcgaagccattg
ctactccggtccaagagcgactacgcgcggcccatggacgaaccagagatcgtgaaggac
gatatacccgaatggggcgctaggcacggcttcgaggatcactaccagtccgaggacata
atatcagacctggctaataattggtacatgtacttcaccgataaacgacacgagacgaca
ggcaaacccaagccgcttcaatatgagcttcaagactggcgacagagagacaggctaaag
acagtctctgcggccctcgcagtgtgtttgaacatcggagtcgaaccacccgaccagctc
aagacgagcccaggcgcgaagctcgaggcctggacggacccgacgatcccgcccatccag
aaagctctcgagaacatcggcaaagcactacaggcgcagtatgagaccttggcgattaga
gcccgctacaagcagtatctggacccttcggttgaagaaacgaaaaagttctgcatctcc
ttgcgtagaaacgccaaggatgaacgtgttttgcttcactacaacggccacggcgtgccc
aagccgaccgcatcaggcgagatctgggtattcaacaagaactacacccagtacatcccc
gtctcgttgtacgatttgcaacactggctgcaagcccctaccatcttcgtttgggactgc
tccgaggctggcaacatcctcaacaactaccatcgattcgtcgaaaagcacgaggaggag
gaggaagaagctgccgagcgtgaccccaactacacaaagaccaacttccggccatacatc
catctggctgcatgtgccgtcaaggaaaaccttccgacgaatcctctcttgccggctgac
ctcttcacggcttgtctcacaacacccattgagatggcgctctggttctttgtccttcag
aacccactcaagaccaacctcagcccagaccgagccaagaagctccctggccgcctacag
gaacgacgaacaccattgggcgagctgaactggatctttacggccattactgacagcatt
gcgtggacaacccttcctcgcgacctcttccgcaagttcttccgccaggatctgatggtg
gcagctctattccgcaacttcctgctcgctcaacgcgttatgactgtgtacggttgtcat
ccacagtcttacccacagcttccagacactcaccagcaccctctctgggagacttgggat
ctggctgtcgacatggctctggctcagctccccatgctggagaagaaggagagcgagggt
ctcgactacgagtaccagaattcgacatttttcacagagcaactcactgcttttgatgtc
tacctgacgagaggcgacgccatggcccagaagtcgcctgaccagctacccgtcgttctc
caagtactgcttagccagcagcatcgagttcgcgcactcattctacttggccggttcctt
gatctgggcccctggtcggtacagctcgctctgagtatcggcatcttcccctatgtcctg
aagcttttgcagtctgcggctgccgagctcaagccagtgatggtcttcatctgggcacga
ctcatagcagtagatatatcatgccagcaagacctgattaaggatagcggctacagctac
tttgcccagattctcaaaccctcggaggggctgccagttgtcgatagcgacgagcacaag
gccatgtgcgccttcatcctggccatgctctgcaaggactacaagaacggccagatggtt
tgcaaccagacagacatcatgacctactgcttgacacatctgcagaacgaggagaaccca
cttttgcgacaatgggcatgcctgtgcataagccagctgtggcaggatctccccgaggct
aaatggcgtggaatcagggagaacgcctacgtcaagttggcctatctcacaaaggacccc
tgctcctatgagcaactggtagaggagaaagagtatctaatgtaccctcctcaggatgac
ggccaggagcacaaaatgggcctccattacgccaggcctgaacaccgtaaccaggacgga
acgatcaagtcgacctcccagggcttgtctcacaacactgtctacatggcgctatggaaa
ctggcgctggtgctcagcgtggatcctcaccccgaagtgcaacgagaggcgaccatcgtg
gttgacttcgttcaccacaccctcctcaactcgagtgttggcgccccagcacagctagtc
atggctgagatccagaagcgtgcttcgaggttggcacaccgtcacacacccagcgccagt
caacggacaagcgccgcgaacgctcaagttacgcaaccattgccttcccctggactgctc
cgtaggactgccagtctcctattcccttcgttgatgaacaccgaggacaggtcaagacca
tcaacgccgacaacaccaactccaccgcttcctcgatcaccctcgctgaagctcacgcat
agtcccgtaccacctgaacagaatgatcaatcatcgtcatttgcacaatatcatctcgct
cctgaaccctactccggcgcctaccagaatcgaaacttggcaaagcccccaacccttccg
ctcaagagcaggttcttagaatggtcgatcgagtacttccgcgagccacaaatgaagcca
agtgaggcggacgagcccggaagcaccgagtacaacgagcgtctctggcgaagagctcgc
aacgaggctatcttccgagagactcagccattgaagcaacaagccggaagtcataagtgg
aacaaccagctcggtatcgttaacaacggtgctcagcccgccaagatgaccttccaccag
tttgaggatcaccttgctgtagccgatgaaggtaataccgtctatgtgtgggattggaag
aaacagggccgcttgagtcgattcagcaacggaaacccagaagggtccaggatcagcgac
atgaagttcatcaacgaagacgaccaggcgatgcttctgacgggctcctcggacggtgtg
atccgggtataccgcaactacgagtccgacagagagattgagcttgcgtcgtcttggcgc
gccctgacacacatggttcccagcaacgtcaattcaggcatggtgtttgactggcagcag
gtgacgggccgagtccttgttgctggtgatgtccgagtgattcgagtctggtatgcggcg
tacgagacctgtatcatggacatcccagcgcggtctgggtcgtgcgtaacatcattgact
tcggatcagatgacgggacacatgtttgttgccggcttcggagacggagctgtacgagtg
tttgataccagaaatcgacctcaagagtccatggtgcgcaagtggaaggatgagtcagat
cggcaatggattaagagcgtccatatgcagcgcggaggtcagcgggagctcctgagcgcg
agccgaaacggcaaggtcaaggtgtgggatattcgcatggacaagcctctgcattctttc
cagacaacacgagatactcttcggaccgcgaccacgcatgaacacctgccggtctttgct
gtgggaacgtcagcccactcggtcaaggtctttaacctcgacggccatgagctctccaac
gttgagccatactcaagcttcctgcagcagagccgaagctcgcccatttcggcgacggca
ttccacccccaccgacccatcctggggtgcgccgctaagggcgaccaccacatcaacctg
ttcacctgcgagaagtctgagccgctgtccctgggctag

DBGET integrated database retrieval system