KEGG   Nectria haematococca: NECHADRAFT_103967Help
Entry
NECHADRAFT_103967 CDS       T01612                                 

Gene name
FUS3
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NECHADRAFT_103967 (FUS3)
Protein kinases [BR:nhe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NECHADRAFT_103967 (FUS3)
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NECHADRAFT_103967 (FUS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 355 aa AA seqDB search
MSRSNPPNPTGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHS
MFCLRTLREMKLLRYFNHENIISILDIQKPRNYESFNEVYLIQELMETDMHRVIRTQDLS
DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSG
FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILD
VLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKTSDLALDLLEKLLAFNPVKRI
TVEEALKHPYLEPYHDPEDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgatcgaacccccctaaccccacggggtcacgcaagatctctttcaacgtcagt
gagcagtacgacatccaggatgtggtaggcgagggtgcatatggtgtggtttgctccgcc
attcacaagccttccggccaaaaggtcgctatcaagaagatcacccccttcgatcactcc
atgttctgtctaagaaccctgcgcgagatgaagctgctgcgatacttcaaccatgagaac
atcatctccatcctcgatatccagaagccccgaaattacgagtcatttaacgaagtctac
ctcatccaggagctcatggagacggatatgcatagagtgatccgcacccaggacctgtcg
gacgaccactgccagtacttcatctaccagacgctccgcgcgctcaaggccatgcactcg
gccaacgtgctgcaccgtgatctcaagccctcgaacctgctgctcaacgccaactgcgat
ttgaaggtgtgcgatttcggtcttgcgcgatctgcggcttcgcaagaggacaactcggga
ttcatgaccgaatatgtcgcgactcgatggtaccgcgcacccgagattatgttgactttc
aaggagtacaccaaggccattgacgtgtggtccgttggctgcattctggctgagatgctc
agcggcaagcctcttttccctggcaaggactatcaccaccagttgacgctgatcctggac
gtgctgggcacgcccacgatggaggactactacggaatcaagtcgcgccgtgctcgagaa
tacattcgatctctgcctttcaagaagaaggtgcctttccgaacgctattccccaagact
tcggacctcgctctcgacctgctcgagaagctcctcgcattcaacccggttaagcgcatc
acagtggaggaggctctgaagcacccatacctcgagccctaccatgaccccgaggacgag
cccacagcgcccccgatccccgaggagttctttgactttgacaagcacaaggacaacctc
agcaaggagcagctgaagcagctcatctaccaggagattatgaggtaa

DBGET integrated database retrieval system