KEGG   Nectria haematococca: NECHADRAFT_104200Help
Entry
NECHADRAFT_104200 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NECHADRAFT_104200
    1.3.1.94  polyprenol reductase
     NECHADRAFT_104200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 319 aa AA seqDB search
MDLLQSSIDVASFLTPAQWCQGFFVLSAGLILFIQALPQDVRSALMDYGPRRPNDAKQAS
GKPEAPKQSFKAVRSLLKTLTNYGQVPHSWFLHFYIISVSFSAFWAWQYTQKGTVMRTIA
TLQDRPQESSMSLEQVFVAWLFMALQGSRRLYESLCVSKPGSSPMWFVHWALGLGYYTAM
SVAVWIEGSSAILASWDSPNQPIQVPRKVPSALALYVVACLKQNQCHRYLASLKKYTLPS
EGWFEYLVCPHYTCECLLYVAIAWIAAPPGQLLNKTVLCGLLFVAVNLGATAHGTRKWMA
NKFGADKVAKRWTMIPLVF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggatctgctacagagttcaattgacgttgcgtctttcttgacgccggcgcagtggtgt
caaggcttcttcgtcctttcagccggcctcattctcttcatccaggctctcccgcaggat
gtccgcagcgctctcatggactacggccctcgacgacccaatgatgccaagcaagccagt
ggaaaaccggaagctccaaagcagagtttcaaggctgtcaggtcactcctcaagaccttg
acaaactacggacaagtgcctcactcatggtttctgcacttctatatcatatcggtgtcc
ttttctgctttctgggcatggcagtatacccagaagggcacagtcatgaggacgattgcg
accctgcaagatagacctcaagagtcatcgatgagtctggaacaggtattcgtggcctgg
ttattcatggcattgcagggctcgagacggctttatgagagtttatgcgtgtcaaagccg
ggatcatcacccatgtggtttgtccactgggcgcttgggcttggatactacactgcaatg
agcgtcgccgtctggatcgagggctccagcgcaattctcgcatcctgggactcacccaac
caacccatccaagtcccgcgaaaggtgccatcggccctggccctgtacgttgtggcatgc
ctcaagcagaaccaatgccataggtatctggcaagcctcaaaaagtatacgcttccaagc
gaagggtggtttgaatatctggtctgcccacactacacctgcgaatgccttttgtacgtc
gccattgcctggattgccgcacccccaggtcagctcctcaacaaaacggtcctatgcgga
ctcttgttcgtggctgtgaacctgggcgccacagcacacggcacgaggaagtggatggcc
aacaagtttggagcggacaaggtggccaagaggtggacaatgatccctctcgtattctag

DBGET integrated database retrieval system