KEGG   Nectria haematococca: NECHADRAFT_104662Help
Entry
NECHADRAFT_104662 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
nhe  Nectria haematococca
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NECHADRAFT_104662
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NECHADRAFT_104662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 855 aa AA seqDB search
MDEGVGMQLLLEGKKTLTIGVDALELSDPVAKRSGRSSCSPLSSRPVSKNSVPLYNVLWA
ELSDNRITVDYAIHASKTLIKPGKWSFALAVMDEAGSGTSPESFVKTLLSRAYGDAPPQK
RAYVLINPNSGPGGAVKKWESEVKPLFDAARLQLDVVVLKRGGEATELAEKADLSRYDTI
MACSGDGTPHEIFNGLAKRPDAAKALASIAVSHIPCGSGNAFSCNLYGSHRASFAALAII
KGVVTPMDLVSVTSGSNRIISFLSQTLGIIAESDLGTEHLRWMGSARFEVGVLQRMFKRT
CYPCDLAVKVEIDEKEGVKAHYKHHASNTSLAALAKAAEAAPVESEGLPALKYGTVQDDL
PEGWELVPYDKIGTFYAGNMAYMSPDANFFSASLISDGCMDLVTIDGDLPPFTALGVLLD
VEADKLFDNPHVTYKKITAYRIIPRNQDDGFISIDGEKIPFGPIQAEIHQGLGRVISKAG
KYEAKGPANWDKHKNRITTANPLCATETRSRDASARKQDALWLLHSETQKWYYNQIIRRF
MSFCTDAGERDELLRRLDSLDIRAVDAALASAPRQPTPKQPRGTPIQSTGVTAATERLAS
LSIAGPSSDASRLPSSASLPTIAESSASASAKPSKEIQPIIPPSGPSDSMKAALQNPSNT
KELQDVLMALRKLREGLVASKRADEFACQAYIFSIRLSIFVKHPESYHPAMLHLLRYIAK
WHNMPHGELAEIASYYALDAACRRKNLAEAYSIRNDFKIKNRKLDIILSALAHDNYVAWQ
NIKYKVDLPFNKLMEWADDDMRLHTLKCFGASYLNVDLPFLEFCTSRKWDELKEKDSVGW
ELEEEKVTIRRIKKK
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggacgagggagttggaatgcagctcctgctggagggcaagaagacgctgacgatcggt
gtcgatgctttggagctcagcgaccctgttgcaaagagatcgggccgctcatcttgtagc
cccctttcttctcgacccgtctcgaagaacagtgttccactgtacaacgttctctgggcc
gagctctccgacaatcgcatcaccgtcgactatgccatacacgcgtcgaaaaccctgatc
aagcccgggaaatggtcgtttgccctcgcggtgatggacgaggccggtagcggtacctcc
cccgagagcttcgtcaagaccctcctatcgcgcgcatacggcgatgcgcctccccagaag
cgcgcatatgtcttgatcaacccgaactctggtcctggaggtgccgtcaagaagtgggag
agtgaggtcaagccgctcttcgacgctgctagactgcagctcgatgtagtggttctgaag
cgcggcggcgaggccactgaacttgcggaaaaggcagacctatcgaggtacgatactatc
atggcttgttcgggagacggaacgccgcacgagatcttcaatggccttgcgaagcgacct
gatgctgccaaggcgcttgcttcgattgctgttagccacatcccctgtggttcaggaaac
gcattctcttgtaacctctatggatcccaccgggcctcctttgctgcccttgctatcatc
aagggcgtcgtgactccgatggatctggtctcggttacgtcaggcagcaaccgcatcatc
tcgttcctgtctcagaccctaggcatcatcgccgagagtgatctgggcactgagcacctt
cgatggatgggcagtgcccgattcgaggttggagtcttgcagcgaatgttcaagagaaca
tgctatccgtgtgacttggccgtaaaggtcgagattgacgagaaggagggcgttaaggct
cactacaagcaccatgccagcaacactagtctggctgcactggccaaggccgccgaggcg
gcgcctgtggagagcgaaggcctccctgcgctcaagtatggcacggttcaagatgacctt
cctgagggatgggaactagttccctacgacaagattggcacattctatgccggtaacatg
gcatacatgtcgcccgatgccaacttcttctccgcctcgctgatttcggatggttgcatg
gacctcgtcactattgatggcgacttgcctcctttcacggcgctcggggtccttctcgac
gttgaggccgacaagctgtttgacaacccgcatgtcacgtacaagaagatcaccgcgtac
agaatcatcccgcgaaaccaggatgacggcttcatcagcattgatggtgaaaagattccg
ttcggacctatccaggcagagattcaccagggccttggaagggtcatctcgaaggccggc
aagtatgaggctaagggccctgcgaactgggacaagcacaaaaaccggatcacaactgca
aatcccctgtgcgccactgaaactcgatcacgagatgcgtcggcgaggaaacaggatgcc
ctctggttactacactcagagactcagaaatggtactacaaccagatcataaggcgtttt
atgtccttttgtacggatgcgggcgaaagagacgagttgttacgaaggttagattcgctt
gacataagggcagtcgatgctgccttggcttcagccccccgacaacccactcctaagcaa
ccgcgaggaacaccgatacagtctaccggagtcacagctgctacagagaggcttgcatca
ttatcaatagcgggaccttccagcgatgcttcccgtctaccgtcttccgcctcacttccg
accatcgctgaatcctcagcttcggcttcagcaaagccttctaaggagattcaaccaatt
attccacccagcggtccatccgactctatgaaggcggctcttcagaatcccagcaacaca
aaggagcttcaagatgttttgatggcgcttcggaaacttcgagagggcctggtggccagt
aagcgtgccgatgagttcgcctgccaggcctacatcttttctattcggttgtcgatattt
gtcaagcaccccgaatcttatcaccccgccatgcttcacctccttcgatacatcgcgaaa
tggcacaacatgccgcacggcgagctcgcggaaatcgcttcctactacgctctggatgcc
gcgtgccggcgcaagaacctggccgaggcgtattctatcagaaacgacttcaagatcaag
aacagaaagctggatattatactaagcgcgcttgcccacgacaattatgtcgcttggcag
aacatcaagtataaggtggacctgccattcaacaagctgatggaatgggcagacgacgat
atgaggcttcataccctgaaatgttttggggcctcgtaccttaacgtggatctaccgttc
ttggagttttgcaccagtcgcaagtgggatgagctgaaagagaaggacagtgttggttgg
gaactggaagaagaaaaggtgacaattcgaagaatcaagaagaagtga

DBGET integrated database retrieval system