KEGG   Nectria haematococca: NECHADRAFT_104852Help
Entry
NECHADRAFT_104852 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NECHADRAFT_104852
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NECHADRAFT_104852
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NECHADRAFT_104852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 777 aa AA seqDB search
MACPHLESIGLNPPTPAQSVYREDCTQCFDSIDDPAGLDVCLQCFNGGCAGDRMHNRLHA
ALKSHPLTLNIRRTRKVVERDEPPAKMSKLAIAAETEEDRYDTALSVKCLECNTELDRTN
PKLAPMVDSILKANTFSRKEEVKAWEQELTSCEHILMLQQHPSRKIEQGALGHCYACDLN
ENLWLCLECGNLGCGRKQMGGVDGNSHALAHSNEAGHGVAVKLGSITPEGTADIYCYKCD
DERVDDNLGEHLAHWGIVLAERQKTEKSLTEMQIEQNLKWDFSMTTEDGKELVPLFGPSL
TGLKNLGNSCYLASITQCLFDMPSFQERYFRPNDDLPIVQDPAEDLETQLRKLADGLLSG
RYSKPDSDVGGDGITHQKGLAPAMFKHLIGRGHEEFSTMRQQDAFELLQHLFKLITRSQH
QGGLKDPTEPFRFALEQRLQCLGCKKVRYSSTEQDNIFIDVPLEKLPAEEGSDGPAAYKP
VTLKECLDNFTATEKVELTCSACGSKDGFVKRYLFKTFPDTLVVNARKMTVVNWVPIKVD
VPVIVPDEPFPLDSYLSQGLQPGEEQLPDEPEAKAPAFEPDATALAQLEAMGFPRNRCER
ALHATGNSDANAAMEWLFGHMEDPDIDAPLDLGGQSAGGDTADPEKIEMLGAMGFGAPQA
KKALKETGGDVERAVEWLFSHPDDQGTFDDDAPAEGATSASKEPAGSATLPATFQLRSIV
CHKGTSIHAGHYVAFIRKALGDANTPTWVLFNDEKVVEAHDVEEMRKFAYVYFFKRV
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccctcatctcgagtcgatcgggctcaacccccctacgccagctcaatctgtc
tatcgcgaagactgtactcagtgttttgactcgattgatgaccccgccggcctcgatgtc
tgcctccagtgcttcaacggcggctgcgctggcgaccgcatgcacaatagactccacgct
gccttgaaaagccaccctctcaccctcaatatccgccgaactcgaaaagtcgtcgaacga
gatgagccacctgccaaaatgtccaagctggccatcgctgccgagaccgaggaggatcga
tatgacactgccttgtccgtcaagtgtctcgaatgcaataccgagctcgaccgaacaaac
ccgaagctcgcccccatggttgacagcattctcaaggccaacaccttttcccgaaaggag
gaggtcaaggcttgggaacaggagttgactagttgcgagcatatcctgatgcttcagcag
cacccttcgcgaaagattgaacaaggtgccttgggccattgctacgcatgcgacttgaat
gagaacctctggctgtgcctggagtgtggcaacctgggatgtggtcgcaagcagatgggc
ggtgttgatggaaactcgcatgctctggctcactcgaacgaagctggtcacggagttgct
gtcaagctcggatccatcactccagagggtaccgcagacatctactgctacaagtgcgac
gacgagcgagtcgatgacaacctgggcgaacatctggcccactggggcattgtactagcg
gagcgccagaagaccgagaagagcttgacagagatgcaaattgagcaaaacctcaagtgg
gactttagcatgacgaccgaggatggcaaggagctcgtcccccttttcggccctagcctg
actggcttgaagaacctgggaaacagctgttatctcgccagtatcactcagtgtcttttc
gacatgccctcattccaggagagatatttccgacctaacgatgaccttcccatcgtacag
gatcctgcagaagaccttgagactcagctacgaaagttagccgatggacttttgtctggc
agatactccaagcccgattccgacgttgggggagatggcatcacccaccagaagggattg
gcgccggccatgttcaagcatctcatcggccgaggacatgaggaattctccaccatgcga
caacaggatgcatttgagttactgcagcatctcttcaagctcatcacccgatctcaacac
caaggtggtctcaaggatcctacagaaccattccgttttgcccttgagcagcgtcttcag
tgtttgggctgcaaaaaggttaggtatagcagcactgagcaagacaacatctttattgat
gttcctctggaaaagctccccgccgaggagggctcagatggcccagcagcttataagccc
gtgaccttgaaggagtgtttggacaactttacggctaccgagaaggtcgaactgacctgc
tctgcttgtggaagcaaggatggctttgtcaagcgataccttttcaagaccttccctgat
accctggttgtcaacgctcgaaagatgacggtggtcaactgggttccgatcaaggtggat
gtgccagtcatcgtgcccgatgagcctttccccttggatagctatctatcacaggggctc
caacccggagaagagcagctgcctgatgaaccagaggccaaagcaccagcctttgaaccc
gatgcgacagcgctggcacaactggaggccatgggcttccctcgtaaccgatgtgagcgt
gctctgcatgctaccggaaactcggatgccaacgccgccatggagtggctctttgggcat
atggaggaccccgatattgacgctcctctggatcttggtggacaatctgccggaggtgat
actgctgatcctgaaaagattgagatgcttggagccatgggcttcggcgctcctcaggct
aagaaggcactgaaggagacaggcggtgacgtcgagcgcgctgttgagtggctcttcagc
cacccagatgatcagggaacctttgacgatgacgcgcctgctgaaggggccacatcggcg
tcaaaggagcctgccggaagtgcaacactgccagcaactttccagcttcggtcgattgtg
tgccacaagggcacaagtatccatgctggacactatgtcgcctttatccgcaaggcgttg
ggtgacgccaacaccccaacctgggtgctcttcaacgatgagaaggtggtggaagcgcac
gacgttgaggagatgcgcaagtttgcctacgtgtactttttcaagcgggtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system