KEGG   Nectria haematococca: NECHADRAFT_105366Help
Entry
NECHADRAFT_105366 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nhe  Nectria haematococca
Pathway
nhe00230  Purine metabolism
nhe01100  Metabolic pathways
Module
nhe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NECHADRAFT_105366
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NECHADRAFT_105366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase AAA_22 MMR_HSR1 AAA_16 ABC_tran AAA_24 Rad17 Septin AAA_14 AAA
Motif
Other DBs
NCBI-GeneID: 9665587
NCBI-ProteinID: XP_003050143
JGI: 105366
UniProt: C7YUL3
Position
9
AA seq 193 aa AA seqDB search
MASPSDRRPLVICGPSGVGKGTLIKLLFSRHPDIFTLSVSHTTRGPRDGETDGVEYHFVT
KEAFRELIANDGFVEHAQFGSNLYGTSKATIQEQTAKGRVVVLDIEMEGVKQVKASSIDA
RYVFVAPPGNEELEKRLRGRGTETEDSIQQRLARAKDELAWAESAKFDKILVNDDLEKTY
DELDAFVYEKSLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccctccgaccgtcgaccactcgtcatttgcggccccagcggtgtcggcaag
ggcacgctcatcaagcttctcttcagccgccaccccgacatcttcactctctccgtgtcg
cacacgactcgcggtcctcgagatggcgagactgatggtgtcgagtaccactttgtcacc
aaggaggctttccgggagttgatcgccaacgacggattcgtcgagcacgcccagttcgga
agcaacctatacggtacgagcaaggcgacgatccaggagcagacagccaagggccgagtc
gtggtcctcgacatcgagatggagggcgtcaagcaggtcaaggcttcgagcatcgacgct
cgctacgtctttgtcgcaccccccggcaacgaggagctcgagaagcgcctgcgaggccgc
ggcaccgagacagaggacagcatccaacagcgtctcgcgcgggccaaggacgagcttgcc
tgggctgagtcggccaagtttgacaagatccttgtcaacgatgatttggagaagacatac
gatgagctggatgcttttgtctacgagaagagcctgccctaa

DBGET integrated database retrieval system