KEGG   Nectria haematococca: NECHADRAFT_105800Help
Entry
NECHADRAFT_105800 CDS       T01612                                 

Gene name
HDA2103
Definition
histone deacetylase
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NECHADRAFT_105800 (HDA2103)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 497 aa AA seqDB search
MDIDSYRYRVPKPNYLPHVADEDRDNTVVEEYTPLGLASEMDNAKFYNKCKRLAEESGIT
RPKGYKVSFHCNPDIESHHFGVTHPMKPWRLTLSKSLIYSYGMSFAMDNYIARAATYEEL
ADFHSTDYLDFLGTVLPEPVPRDLENQAVDLKFNLGGSDCPLFDGLFNYCSLSAGGSLDA
ARKICSGQSDIAISWGGGLHHAKKSEASGFCYINDIVLAVLQLLRYYPRVLYIDIDVHHG
DGVEEAFFSTDRVMTVSFHKYDPQNFFPGTGALDDNGPKSEHNPGAHHAFNVPLMDGITD
EQYDGLFNSIIGKIVEKFRPGAIALQCGADSLAGDRLGRFNLQVQGHGACVKFCKEMRIP
MILFGGGGYTPRNVARAWTYETSIATNCDDKISSILPEHAPWRDHFRQDTLFPTLEQILG
EPRQNRNSQKRLAEITQHITEQLRFVQAAPSVQFQTIPPDLGAIRDEVEERLKEENEERR
DEVRRAREAAVGTAMEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatatagactcttacagataccgggttcccaaacccaactacctaccccatgttgca
gatgaggatcgtgacaacaccgtcgttgaggagtacacgcccctcgggctagcgagcgag
atggacaacgccaagttctacaacaagtgcaaacgcctcgccgaagaatcaggcatcacc
cggccaaagggctacaaggtgtcgttccactgcaacccggacatagagagtcaccacttt
ggagttacacatcccatgaagccctggcgtctgacgttgtccaagagcctcatctattct
tacggcatgtcattcgccatggataattacatcgcccgagcagccacttacgaggagctg
gccgactttcactcgacagattacctcgactttctcggcacagtcctgcctgagccagta
cctcgcgaccttgagaaccaggctgttgacctgaagttcaacctgggcggctctgactgt
ccactctttgacggtctattcaattactgttctctctcagccggtggctccctggatgct
gccaggaagatctgcagtgggcagtccgacattgctatttcctggggcggtggactgcat
cacgccaagaagtctgaagcttctggcttctgctacatcaacgacattgtactcgctgtc
ctccagctcttgcgttattaccctcgagtcctatacatcgacattgacgtacaccatggc
gacggtgtcgaggaggctttcttctcaactgaccgtgtcatgactgtgtccttccacaag
tatgacccgcaaaacttcttcccgggcacgggagctctcgacgacaacggtcccaagagt
gaacacaacccaggcgctcatcacgctttcaacgtaccattgatggacggtatcacggat
gagcagtatgatggtctgttcaactctatcatcggcaagattgtggagaagttccgccct
ggagccattgccttgcaatgtggtgccgactctctggcgggtgaccgccttggtcgcttc
aaccttcaagtccaaggccacggtgcctgtgtcaaattctgcaaggagatgcgcatcccc
atgatcctcttcggtggtggtggatacactcctcggaacgtggccagggcatggacttac
gagaccagcattgccaccaactgcgatgacaagatcagctccatcctaccagagcatgct
ccatggcgtgaccactttaggcaagacacgcttttcccaacactggaacagattcttgga
gagccacgacaaaatcgcaattcccagaaacggttggcagagattactcaacacattaca
gagcagctccgctttgtgcaggcagcaccgagcgttcagttccagaccatcccacctgat
cttggtgccattagagatgaagttgaggagcggctcaaggaggaaaacgaggagagacga
gacgaagtccgcagagcgcgagaggccgctgtggggacagcaatggaactttag

DBGET integrated database retrieval system