KEGG   Nectria haematococca: NECHADRAFT_105852Help
Entry
NECHADRAFT_105852 CDS       T01612                                 

Gene name
HAG2101
Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NECHADRAFT_105852 (HAG2101)
Transcription machinery [BR:nhe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NECHADRAFT_105852 (HAG2101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 396 aa AA seqDB search
MPDENGKRKAEEDPTSPTPSKRIKQDDSAEPPDKKSAIKPIPFPEKPAVIEERNGEIEFR
VVNNDNERESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITY
RPFKGRRFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKK
QGFTKEITLDKKVWMGYIKDYEGGTIMQCSMLPRIRYLEMGRMLLKQKECVQAKIRAYSK
SHNVHAPPKEWKNGITEINPLDIPAIRASGWSPDMDELARQPRHGPNYNQLLHLLNDLQN
HNSAWPFLVPVNRDDVADYYDVIKEPMDLSTMESKLEADQYLTPEDFIKDAKLVFDNCRK
YNNESTPYAKSANKLEKFMWQQIKAIPEWSHLEPER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgagaacggaaagcgcaaggccgaggaggacccgacctcccctaccccctct
aagcgtataaagcaagatgactctgccgaacctccagacaagaagtcagccatcaaacct
atcccattcccagaaaagccggccgtcatcgaagagcgcaatggcgagatcgaattccga
gtagtcaacaacgacaacgagcgcgaatccctcataattctcaccggtctcaagtgcatc
tttcagaaacaactcccaaagatgcctaaggattacatcgcccgacttgtttacgatcgc
actcatctgtccatcgccattgtcaagaagcctctggaagtcgttggtggcatcacatac
cgcccattcaagggtcgccgcttcgccgagattgtcttttgcgccattagttctgatcag
caagttaagggctatggcgcgcacctaatgtctcatctcaaggattacgttaaggctact
agcgacgtgatgcacttcctcacatacgccgacaactatgctattggatacttcaagaag
cagggcttcaccaaggagattactctcgacaagaaggtctggatgggttatatcaaggat
tacgagggtggaaccatcatgcagtgctcgatgctgccgcggattcgatacctcgagatg
ggtcgcatgctccttaagcagaaagaatgcgtccaagccaagatccgcgcctactccaaa
tcacacaatgttcacgcgccccccaaggaatggaaaaatggtatcaccgaaatcaaccct
ctcgacattcccgcgatccgagcatcaggctggtcaccagatatggacgagctagcccgt
cagccccgtcatggacccaactacaaccagctcctccatcttctcaacgacctgcagaac
cacaactcggcttggcccttcttggttcccgtcaatagggacgacgttgccgattactac
gatgtgatcaaggagcccatggacctgagtaccatggagagcaagctcgaggctgaccag
tacctcacacccgaggacttcatcaaggacgcgaagctcgtctttgacaactgccgcaag
tacaacaatgagagcacgccgtacgcaaagtcggccaacaagctcgagaaattcatgtgg
cagcagatcaaggccattcccgagtggtcccatctagagccggagaggtag

DBGET integrated database retrieval system