KEGG   Nectria haematococca: NECHADRAFT_105884Help
Entry
NECHADRAFT_105884 CDS       T01612                                 

Gene name
nec52677
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NECHADRAFT_105884 (nec52677)
   01230 Biosynthesis of amino acids
    NECHADRAFT_105884 (nec52677)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_105884 (nec52677)
   00051 Fructose and mannose metabolism
    NECHADRAFT_105884 (nec52677)
   00562 Inositol phosphate metabolism
    NECHADRAFT_105884 (nec52677)
Enzymes [BR:nhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NECHADRAFT_105884 (nec52677)
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NECHADRAFT_105884 (nec52677)
  Exosomal proteins of bladder cancer cells
   NECHADRAFT_105884 (nec52677)
  Exosomal proteins of melanoma cells
   NECHADRAFT_105884 (nec52677)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 256 aa AA seqDB search
MASIQRPNRRIVGVSTKLYFSAARTREYVDQLLQLLSVDSSLLNDIDVFIIPDHVTLVSV
INQVKDHKIWCGAQDTFWEDSGAYTGEVSSSVLAEVGTRLVEVGHAERRRIFGETDEITA
KKAAAAARNGMIPLVCIGEQTRGETHTTAVTQCQTQIEAVLSAVPEDAEVVFAYEPVWAI
GAAEPAAADYVVGVTSAIRKLESIQKRSGSTRILYGGSAGPGLFEKLKDGVDGLFLGRFA
HDPDRFVKTIQEVARG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcatctattcaacgacctaatcgccgcatcgtcggcgtctcgacaaagctgtacttc
tccgccgctcgtacccgggagtatgtcgatcagctcctacaactcctctccgtcgactct
tcactcctcaacgatattgacgtcttcatcattcccgaccacgtaactctcgtatcagtc
atcaaccaagtcaaagaccacaaaatctggtgcggtgcccaagataccttctgggaggat
agcggcgcctacacaggcgaagtatcgtcttcagtcctagccgaagtcggaacccgtctc
gtcgaggtcggccacgcagagagacgtcgaatctttggcgaaacggatgaaatcacggca
aagaaagcagccgctgccgcgcggaacgggatgatccccctggtctgcatcggcgagcaa
acccggggcgaaacccacacgacagccgtgacccaatgccaaacccagatcgaagccgtc
ctatcagccgtcccggaagatgccgaagtagtctttgcctacgaacccgtctgggccatc
ggagcagcggagccagcagctgctgattatgtggttggtgtcacgtctgcgattcggaaa
ctggagagcattcagaagagaagcgggtctacgaggattttgtacggggggagtgcggga
ccgggattgtttgagaagctcaaggatggtgttgatggattgtttttggggaggtttgct
catgatcctgacaggtttgtcaagacgattcaggaggttgctcggggatga

DBGET integrated database retrieval system