KEGG   Nectria haematococca: NECHADRAFT_105884Help
Entry
NECHADRAFT_105884 CDS       T01612                                 

Gene name
nec52677
Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00051  Fructose and mannose metabolism
nhe00562  Inositol phosphate metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
nhe01230  Biosynthesis of amino acids
Module
nhe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nhe_M00002  Glycolysis, core module involving three-carbon compounds
nhe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_105884 (nec52677)
   00051 Fructose and mannose metabolism
    NECHADRAFT_105884 (nec52677)
   00562 Inositol phosphate metabolism
    NECHADRAFT_105884 (nec52677)
Enzymes [BR:nhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NECHADRAFT_105884 (nec52677)
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NECHADRAFT_105884 (nec52677)
  Exosomal proteins of bladder cancer cells
   NECHADRAFT_105884 (nec52677)
  Exosomal proteins of melanoma cells
   NECHADRAFT_105884 (nec52677)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9668662
NCBI-ProteinID: XP_003045828
JGI: 105884
UniProt: C7Z6D9
Position
2
AA seq 256 aa AA seqDB search
MASIQRPNRRIVGVSTKLYFSAARTREYVDQLLQLLSVDSSLLNDIDVFIIPDHVTLVSV
INQVKDHKIWCGAQDTFWEDSGAYTGEVSSSVLAEVGTRLVEVGHAERRRIFGETDEITA
KKAAAAARNGMIPLVCIGEQTRGETHTTAVTQCQTQIEAVLSAVPEDAEVVFAYEPVWAI
GAAEPAAADYVVGVTSAIRKLESIQKRSGSTRILYGGSAGPGLFEKLKDGVDGLFLGRFA
HDPDRFVKTIQEVARG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcatctattcaacgacctaatcgccgcatcgtcggcgtctcgacaaagctgtacttc
tccgccgctcgtacccgggagtatgtcgatcagctcctacaactcctctccgtcgactct
tcactcctcaacgatattgacgtcttcatcattcccgaccacgtaactctcgtatcagtc
atcaaccaagtcaaagaccacaaaatctggtgcggtgcccaagataccttctgggaggat
agcggcgcctacacaggcgaagtatcgtcttcagtcctagccgaagtcggaacccgtctc
gtcgaggtcggccacgcagagagacgtcgaatctttggcgaaacggatgaaatcacggca
aagaaagcagccgctgccgcgcggaacgggatgatccccctggtctgcatcggcgagcaa
acccggggcgaaacccacacgacagccgtgacccaatgccaaacccagatcgaagccgtc
ctatcagccgtcccggaagatgccgaagtagtctttgcctacgaacccgtctgggccatc
ggagcagcggagccagcagctgctgattatgtggttggtgtcacgtctgcgattcggaaa
ctggagagcattcagaagagaagcgggtctacgaggattttgtacggggggagtgcggga
ccgggattgtttgagaagctcaaggatggtgttgatggattgtttttggggaggtttgct
catgatcctgacaggtttgtcaagacgattcaggaggttgctcggggatga

DBGET integrated database retrieval system