KEGG   Nectria haematococca: NECHADRAFT_106153Help
Entry
NECHADRAFT_106153 CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 222 aa AA seqDB search
MVSFSYLLAAVSAFTSVLAVPTAETSENPALSKRTQSSTGTHGGYYYSFWTDNPNTVTYT
NQNAGQFSVSWSGNQGNFVGGKGWNPGAARTIKYSGTYNPNGNSYLAVYGWTRNPLIEYY
IVENFGTYNPSSGATKKGEVTVDGSVYDIYTSTRTNAPSIEGTRTFQQYWSVRRNKRSSG
SVNTGAHFNAWSNVGLKLGSHDYQILAVEGYYSSGSATMTVS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtttctttcagctacctcctcgcagctgtgtctgccttcaccagcgttctcgccgtc
cccacggctgagacctctgagaaccctgccctctccaagcgtactcagagctccaccggc
acccacggcggctactactactccttctggactgacaaccccaacactgtcacctacacc
aaccagaacgctggtcagttcagcgtttcctggagtggcaaccagggcaactttgttggt
ggcaagggttggaaccctggtgctgctagaactatcaagtactctggcacctacaacccc
aacggcaacagctacctcgccgtctacggctggacccgcaaccctctgatcgagtactac
atcgtcgagaactttggaacctacaacccctcttctggtgccaccaagaagggagaggtc
accgtcgacggctccgtctacgacatttacaccagcacccgcaccaacgccccctccatt
gagggtacccgcactttccagcagtactggtctgtccgccgcaacaagcgctctagcggc
tctgtcaacaccggtgctcactttaacgcctggagcaatgttggcctgaagcttggatct
catgattaccagattcttgctgttgagggttactacagctctggttctgccaccatgact
gtttcttaa

DBGET integrated database retrieval system