KEGG   Nectria haematococca: NECHADRAFT_106321Help
Entry
NECHADRAFT_106321 CDS       T01612                                 

Gene name
HDA2102
Definition
histone deacetylase
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NECHADRAFT_106321 (HDA2102)
Protein phosphatases and associated proteins [BR:nhe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NECHADRAFT_106321 (HDA2102)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 723 aa AA seqDB search
MKDVDAPNGLKTDNSIDDDDTASEDANSSEEDPEPQDLALDQVRRRGLLPTGCCYDDRMK
LHMNADFSPNTHHPEDPRRIHEIFKAFKKAGLVYTGSEADLPRIIRECPTRYMWRIAARS
ATKDEICLAHSADHFSWVENLDKISTAELRELTRRYDQGRESLYVGSMSYPAALLSAGGA
IETCKNVVTGQVKNAFAVIRPPGHHAEFDAPMGFCFFNNVPVAVRVCQQDYPDLCRKVLI
LDWDVHHGNGVQNIFYQDANVLYISLHVYANGTFYPGKPPNPITPDGGIENCGSGPGLGR
NINIGWHDQGMGDGEYMAAFQKIIMPIAKEFNPDLVVISAGFDAADGDELGGCFVSPGCY
AHMTHMLMSLAGGKVSVCLEGGYNLKAISKSAVAVAQTLMGEPPPKMELPKINKEAARIL
AKVQAHQAPYWECMRPGIVDVPEVQSLNANRLHDVIRNAQRQVLQTKHNMVPLYIQREQL
YKSYENQVLVTPSLHEANKILIIIHDPPQLLAQPDVIDTSLDPHNAWVVDGVTEYIDWAI
SQKFGVMDINVPAYITHEEDSDAYIPGFKEKALQEQIQSLVCYLWDNYLQLYDAENIFIM
GVGNAYLGVKVLLVNRVIDCKARISGVVNFVNGTLRPVKSDIDTDLSSWYKDNSRVYIAG
DHACWSDPDLTRKVHKRRFGTVVRSPKFGLNKMMQAHANEARAWILERVVEASDADMTDD
EKQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgtcgatgcgcccaacggactcaagacggacaacagcatcgacgacgacgac
actgcgtccgaggatgccaactccagtgaggaggaccccgaacctcaggatctcgcactt
gatcaggtgcggcggcgaggtctacttcctacaggctgctgttatgatgacaggatgaaa
ctccatatgaacgcagacttcagtccaaatacccatcatccagaagacccccgcagaatc
cacgagatcttcaaggcgttcaagaaagcgggcctcgtctatactggctccgaggcagac
cttccaaggatcataagagaatgtcctacacgatacatgtggcggatagctgcccggtcg
gcgacaaaagacgagatctgtcttgctcactcagccgaccatttcagctgggttgagaat
ctagacaagatcagcaccgcggaacttcgagagttgactaggagatacgatcaaggacgc
gaatctctctatgtcggcagcatgtcgtatcccgcagccctcctctccgctggaggcgct
atcgagacctgcaagaacgtcgtcacaggacaggtgaagaacgcgttcgccgtgattcga
ccgccggggcaccacgctgagtttgatgcgcccatgggcttctgcttcttcaacaatgtt
ccagtggccgtcagagtgtgtcagcaagattaccccgatctatgtcgcaaggtcctcatc
ctggactgggatgtccatcacggcaacggagtgcaaaacatcttttatcaggacgccaat
gttctatacatctccctccacgtgtacgccaatggaacattctaccctggaaagccaccg
aatcccataacccccgatggaggcatcgagaactgtggtagtggtcctggactcggcagg
aacatcaacatcggttggcacgaccagggcatgggagatggtgaatacatggcggccttt
cagaagatcatcatgcccatcgccaaggagttcaaccccgacttggtggtcatctctgcc
ggctttgatgctgcggatggtgatgagcttggaggttgctttgtttcaccaggctgctat
gctcacatgacacatatgctcatgtctctagccggcggaaaggtctctgtgtgtctcgag
ggaggctataacctgaaagctatttccaaatcagctgtcgccgtcgctcagacactcatg
ggcgagccgccacccaagatggagcttcccaagatcaacaaggaagctgcgcgcatcttg
gccaaggtccaggcgcaccaggccccgtactgggagtgcatgcggcctggcattgtggat
gtgccagaggttcagtcgctaaatgctaaccgcctccacgacgttattaggaacgcccaa
aggcaagtcctgcaaaccaagcacaacatggtacctctctacatccagcgcgaacagctg
tacaagtcgtatgagaaccaggtgctggtgactccgagtctgcatgaagcgaacaagatt
ctgattattattcatgatccacctcagctcctagctcagccggatgttatcgatacatct
ctcgatccgcataatgcttgggttgttgacggtgtaaccgaatacattgattgggcgatt
agccagaagtttggtgtcatggatatcaacgttcctgcgtatatcacccatgaagaggat
tcggatgcatatatcccaggcttcaaagaaaaggccctccaggaacagattcagtctctt
gtctgctatctctgggacaattatctgcagctatacgacgcagaaaacatcttcatcatg
ggcgtcgggaacgcctatctaggagtcaaggttcttctcgtaaatagagtgatagactgc
aaggcaaggatttccggagtggtgaattttgtcaatggaacactccggccagtcaagtca
gacatcgatacggatctctcgtcctggtacaaagacaactcgcgcgtctacatcgcgggc
gaccatgcgtgctggtccgatcctgacctgacacggaaagtccacaagcgccgcttcgga
acagtcgtgcgaagcccaaagtttggtctcaacaagatgatgcaggcccatgctaacgag
gcacgcgcgtggatcctggagagagttgttgaggcatcagatgcggatatgacagatgat
gagaagcaatga

DBGET integrated database retrieval system