KEGG   Nectria haematococca: NECHADRAFT_106479Help
Entry
NECHADRAFT_106479 CDS       T01612                                 

Gene name
SRT2103
Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     NECHADRAFT_106479 (SRT2103)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 396 aa AA seqDB search
MASTAPKVPLPERRDPPEVIDQQASKLVELIKRSKHFIVFTGAGVSTSAGELLHPVPHNN
SSYSIQNTGIPDFRGPEGAWTLRAQGRARTTKAVSTLQAVPTPSHMALLELQNRGIMKYL
VSQNCDGLHRRSGIRPDMISELHGNSNRECCRDCGKEYIRDFRAVATYEKTVRDHRTGRT
CTRCGGLLHDSIINFGEDLPAEAFQLATDHAEKADLCLVLGSSLTVTPASGIPQICGMRR
NAKLVICNLQNTPFDRISEMRVYSEADNLMTRVMQGLGLPIPTFILKRRLVIKAETDSND
RQSLTLSGVDVDGTPVSYLQSVKLEYNRRLLRSEPFTFSFRSALSPGTDLKFELEFMGHY
NEPNLVVDYQVQDGEGHEAFYDLHYDPSTGEWMTIR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaccgcaccaaaagtccccctccctgagcgccgagatcctcctgaagtgatc
gaccagcaagcatcaaagctagtcgagctcatcaagaggagcaagcactttatcgtcttt
acgggcgcaggagtgtcaacatccgcaggcgagttactccatccagtaccgcataacaat
agctcatatagcatccaaaatacaggtattcccgactttcgtggtcctgaaggtgcctgg
acactcagagcccaggggagagcgcgcaccaccaaggccgtgagcactcttcaggcggtc
ccgacaccgagccacatggcgctgctggaactccaaaatcgaggcattatgaaatatctc
gtcagtcagaattgtgatggactacaccgaagaagtggtatccggccggacatgatctcg
gagcttcacggaaacagcaatcgtgaatgttgcagagattgtggaaaggaatacatccgc
gactttcgcgccgtcgcaacgtacgaaaagactgtccgtgatcatcgaacaggccgcaca
tgtacccgttgcggaggccttctccacgacagcatcatcaactttggcgaggacctaccc
gccgaggcgtttcagctagcaaccgaccatgccgagaaggccgatttgtgcctcgtcctt
ggttcatctctaactgtcactccagcgagtggtataccgcagatctgtgggatgaggcga
aatgccaagctcgtcatctgcaacctccagaatacgccttttgatcgtatttcggagatg
cgcgtttactccgaggcggataatctgatgacacgagtaatgcagggactagggctccct
attcctaccttcattctcaaacgaagactggtcattaaggcagagacggacagcaacgat
cgtcagtctctgacgcttagcggggtcgatgttgacggtacacccgtatcatatctccaa
tctgtcaaactcgagtacaacagacgacttcttcggtctgaaccgttcacgttcagcttt
cggtctgctttaagccctggcacagacctcaagtttgagcttgagtttatgggtcattat
aatgagccgaatttagttgtggactatcaggttcaagacggcgagggccatgaggcgttt
tatgatcttcactatgaccctagtacgggagagtggatgacaattagatga

DBGET integrated database retrieval system