KEGG   Nectria haematococca: NECHADRAFT_122506Help
Entry
NECHADRAFT_122506 CDS       T01612                                 

Gene name
HAG2104
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NECHADRAFT_122506 (HAG2104)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 475 aa AA seqDB search
MVLTSIQGLSNANEAIRISLMAPSKTGLTTIAAFNPSFTHSFFGEDEQIFGYKDLKVNLR
YRANDMRPHLKTTYSSKFKAVGGPEPVDVKVVLEEGHHLPKIAFAKASDFEDSSKQMSEN
WTPPGALHTTIDAPDGQYEIWRGNLADQAVQQLNSRLQILVPFFIDGGSYIGQDLDSGEI
DLSDADRWTFFSLYKKETVAETSTYVFVGYATLFRFYYFRPPTPPASPKDDWELPTGDQD
LAELPCRTRLSQFIILPPFQGKGNGARLYKTVFEYYHKHEQTHEFTVEDPNEAFDLLRDI
CDLQFLKQMPEFCNLKLDADVTIPKKGTLPKLIVGSDQLETIRLKAKIAPRQFGRVLEMY
LMSQLPESVQPTMAIDEKRPAPTKADKHQLRVWKLIAKQRLYRHNKDFLAQIEPHERIER
LDDTLDGVGLEYARILAACERSAKNAQAEPKNGKRKLQEENGEGSSSKKARVEDA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacttcaattcaagggctcagcaacgccaacgaggcgattcgcatcagcttg
atggcgccatcaaagaccggccttaccactatcgcggcgttcaaccctagtttcacccac
tctttcttcggagaggatgagcagatctttgggtacaaagacctaaaggtcaacctgcgg
taccgcgctaatgacatgcgaccgcacctgaaaacaacctacagcagcaagttcaaggct
gttggcggacccgagccagtagatgtgaaggtggtcttggaagagggtcaccacctgcct
aagattgcctttgccaaggcgagcgacttcgaggacagctccaagcagatgagcgaaaac
tggacgcctcccggcgccctgcacacgactatcgatgcgcccgacggccagtacgagatc
tggcgcggaaacctagccgatcaagcagttcagcagctcaacagtcgcctgcaaatcttg
gtcccattcttcatcgacggaggtagctatattggtcaggacctggactctggggagatt
gatctctccgacgccgaccgatggaccttcttctcactatacaagaaggaaacagtggca
gagacgagcacatacgtttttgtcggctatgcaactctcttccgattctactacttcagg
cccccaacgcctccagcctcgccaaaggatgactgggagctgccaacaggcgaccaggac
ctcgcagagcttccctgcagaacacgtctatctcagttcatcatcttgcctcctttccag
ggcaagggcaatggcgctcgcctctacaaaaccgttttcgaatactatcacaagcacgag
cagacacacgagtttaccgtcgaagacccgaatgaggcgtttgatctgttgcgagatatt
tgcgacttgcagttcctcaaacagatgcccgaattctgcaacttgaaactggatgcagat
gtcacgattcccaagaagggaactctgcccaaactcattgtcggcagcgaccagttggaa
acaatccgtctcaaggccaagattgctcctcgccagtttggacgtgttctcgagatgtat
ctcatgtcccaactaccggaatcggtgcagcccacaatggcgatcgacgagaagcgccca
gctccgacaaaagcagacaagcaccagctgagggtttggaagttgattgccaagcagcgc
ctctaccgtcacaacaaagacttccttgctcaaattgaacctcatgagcggatcgagaga
cttgatgataccctggacggtgttggactggagtatgcgcgaatcctggctgcttgtgaa
cgttcagccaagaatgcccaggccgagccaaagaatggcaagcgaaagctgcaggaagaa
aacggggagggttcaagcagtaagaaggctcgtgtggaggatgcctag

DBGET integrated database retrieval system