KEGG   Nectria haematococca: NECHADRAFT_123121Help
Entry
NECHADRAFT_123121 CDS       T01612                                 

Gene name
SDG2103
Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
nhe  Nectria haematococca
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_123121 (SDG2103)
Enzymes [BR:nhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NECHADRAFT_123121 (SDG2103)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 776 aa AA seqDB search
MALDLSAEGSFEVGATDDSSSNVASTTSTPPTTVADEASLHSESPKRDVVHVAEPLEAAP
EPIDTAPPAVPVESVKKVTAAKPAPPPSLRSRRSNVGTPVYNLAKLSGTDGHGKRRAKGD
IVADRRRRKTISGPIVNLTEQATSSPATTDSVRHDIHALSLHQSLKKSDTPRTRLQLTAD
PSPSSRRSSTRRSSAIVPIATPSSAKIIKPAKRSRKAVEQQPAIMSREMRRLADTKEFAG
VDTEPVLLTYWSNGKYVDPNAAKQPQRKKSEPEPAEEEEAEPEPVVNAKKRREKKYLDKG
LYAGQDAPIDISKGLSVAEKKKLAQLPELIPNGRVNKTMPLPMFNGLRNLINGRDFKLPF
NVCNPLPPGQPKPDEWKKMTKNRFIGESKDYWRKSPHFHDYQSKCVCKPEDGCGESCQNR
IMLYECDEQNCNVGKAHCTNRAFATLTARRNQGGKYRVGVEVIKTSDRGYGVRSNRCFRP
NQIIMEYAGEIITEAECERRMTEVYKDNECYYLMSFDQNMIIDATTGSIARFVNHSCNPN
CRMIKWIVSGQPRMALFAGDKPITTGEELTYDYNFDPFSAKNVQKCLCGEPNCRGVLGPK
PREVKPPKSDSKNTVKGAVKGAVKAGKRKLKELIGDDGGKDGGPAKKRKVQPMKQAKRAI
SLASSKVAKGAANALRKGVSTVTSTGRKAALGSKSPAKRRASTGAILKKTTTKRVIQTYA
ARTPKRRGSAGASSITKVTIKTKAKSSRKSITSAASPRRGLDISRETEIEVVQAEE
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgatctgtccgccgagggcagcttcgaggtaggcgctacggatgattcctct
tcgaatgtcgcgtcaaccacttctactcctccaaccactgttgccgacgaagccagtctt
cactcggaatctcccaagcgcgatgtcgtacacgtagccgagcccctcgaggccgctccc
gaacccattgacacagcaccgcctgctgttcccgtcgagtctgtcaagaaggtcaccgct
gctaagccggcccctcctccttctctgcgttctcgtcgcagcaatgttggcactcctgtc
tataacctggccaaactgagcggcaccgatggccacggcaagcgacgcgccaaaggcgac
attgttgcagatcgccgacgacgaaagaccatttctggtccgattgtgaatcttacggaa
caggcaacttcaagccctgcgactactgattccgttcgccatgatatccacgcgcttagc
ctccaccagtctctcaagaaatcagacacaccgcgcactcgcctccagctcactgctgac
ccctcgccatcttcacgccgttcctcgacgcgccgttctagtgccatcgtgcctatcgca
accccgtcgagcgcaaagataatcaagccggccaaacgcagtcgcaaggctgtcgagcag
cagccagcgatcatgtctagggaaatgagacgcttggccgatactaaggagtttgccggc
gttgatactgaacctgtgctgcttacctactggtcaaatggtaagtacgttgaccccaac
gccgcgaagcagccacaacgaaaaaagtcggagcccgaacccgccgaggaggaggaggct
gaaccggagcccgtggtcaatgccaagaagagacgcgagaagaagtacctcgacaagggt
ctttatgcaggccaggatgctcccatcgatatctctaagggtctatctgtggcggagaag
aagaagctggctcagctgcctgagctcattcccaacggtcgtgtcaacaagaccatgcct
ttgcccatgtttaatggcctgcgcaatctcatcaatggccgtgacttcaagctcccattt
aacgtgtgcaacccccttcctccgggccagcccaaacccgacgaatggaagaagatgacc
aagaatcggttcatcggcgagtccaaggactactggcgcaagtcaccacacttccacgac
tatcaatccaagtgcgtgtgcaagcccgaggatggttgcggtgagagttgccagaaccga
atcatgctgtacgagtgcgacgagcagaactgcaacgtcggcaaggcacactgcaccaac
cgcgcatttgcaactttgaccgcacgccgtaaccagggcggcaagtatcgcgtgggagtc
gaggtgatcaagacatcggaccgcggatacggcgtgcgaagcaaccgatgcttccgacca
aaccagatcatcatggagtacgcaggcgaaatcatcactgaagctgaatgcgagcgtcgc
atgactgaagtctacaaggacaatgagtgttactatctgatgagcttcgaccagaacatg
atcatcgatgccacgacagggagcatcgcgcggttcgtgaatcacagctgcaatcccaat
tgcagaatgatcaagtggatcgtttccggacagccgcgaatggccctatttgcaggtgac
aagcctatcacgacgggcgaggagttgacttatgactacaactttgaccccttctccgcc
aagaacgttcagaagtgtctatgtggtgagcccaactgccgaggtgtactcggccccaag
cctcgagaggtgaagcctcccaagtcggattcgaagaacacggtcaagggcgctgtcaag
ggtgccgtcaaggctggaaagcgcaagcttaaggagctgatcggtgacgatgggggcaag
gatggaggcccagcgaagaagcgcaaggttcagcccatgaagcaagcaaagcgagctatc
tccctggccagctccaaggttgccaagggcgcagccaacgctcttagaaagggcgtgtca
actgtcacctcgacaggacgaaaggcggcgctcggatccaagtcacccgcgaagcgacga
gcatcgaccggagccattctgaagaagacgaccaccaagcgtgtcatccagacctacgca
gcacgcacgcctaagcgacgtggatcagccggggcttctagcattaccaaggtgaccatc
aagacgaaggccaagagctctcgcaagtcgatcacctcagcggcgtctcctcgcaggggg
ttggacatttctcgcgagacggaaatcgaggtggtgcaggcggaggagtaa

DBGET integrated database retrieval system