KEGG   Nectria haematococca: NECHADRAFT_123200Help
Entry
NECHADRAFT_123200 CDS       T01612                                 

Gene name
HDA2101
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NECHADRAFT_123200 (HDA2101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1069 aa AA seqDB search
MDHVIQPTDALPETRPVSLRHDNDDLAQSLKQLSISTSPGRAHGSPHLSEPSTPFRASGR
RTSQSPRPNARLPSRSPSQGRDPGSGTPTLLRKASMNSLRSSNGMGAVPTPTRRASTTHI
MSPSPKSPLATPPVQEKPRPTASSIAHDILSAELQAHHSPECASQPQTIVVLNDAVYGHR
FSRPRTSRAALGTIVERPERIKAAVLGISTAYVRLGGRHSEGAFPPHPRRDVEDLPGIPF
RIHKTERKLSLLSPAVVNVHGTKWMEELKMMCEAAESKLAMGGKELQRPELNRGTEKAPE
KFHEGDLYLCSESLNAMEGALGAVCEAIDTVFGPGPQRAFVGVRPPGHHCSASYPSGFCW
INNVHVGIMHAVLNHGLTHAAIIDFDLHHGDGSQAITWQHNTRANAAAKNAAAWKKSSVG
YFSLHDINSYPCEMGDEEKVKNASICIDNAHGQTVWNVHLQSWKTEEEFWRLYETKYSVL
LEKTRNYLKNQAERLRQSNQIPKAAIFFSAGFDASEWESAGMQRHQVNVPTEFYARIAHD
VIKLAAEEGLEVDGRIISVLEGGYSDKALFSGILSHLSGLADDQTYEREPQNLGRLGAEM
GHKIGVLAEEDDEMDTKPSLDSVHSYDPAWWASPRLDELEAIVAGPGGPAAKPHNNTLPT
YFSPTQASTARVADPIKMRRSLSNLGASLSRPPSPPPPEVPWTVAAHELSKLLIPESRQT
DSCKPEDLNAEATRARRDRQSLLLGIDPNPPAPASRPTSRMSLRERRPKPAPPPQPIKDK
APKVFYLYIYPVRRASRRLSEVPTTLASRATSHTSSGNEADLPEGSEAPGPGSPVSTRAP
PGGGLQVKKTRNPVATRKEPAPRAPRTTKKVAPPTASRPPTAAQRIHPSTRPQAKAGPSG
ATGDDIDSITTGMKKIRINLITQSQKEARERARLEAEKQSPEIRGPDSGNISPTQVAAPD
SEIPTPPATISDDDNVFIAYQPEGPTPVAVAQQEPIKWLPPNVQTPTAQTPAATPSPVKK
NNLFQYTEGIPFAPRQGQHAGEQKPTDEGVKSEPPASESVQEIPEAPQQ
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgtgatacaacccaccgacgcgttacctgagacgcgacctgtgagcctacga
catgacaatgatgacttggcgcagtcgttgaaacagctgtccatatccacctcgcccggc
cgcgctcatggctcaccgcacctctccgaacccagcactccctttcgtgcatcaggacgc
cgtacctcgcagtccccaaggcccaatgctcgactcccatctcgtagcccttcgcaaggg
cgcgatcccggctcgggaacgcccacgcttcttcgaaaggcctcgatgaactcgctgcgg
tcttcaaacggaatgggagctgtcccgactcctactcgacgtgccagcaccacacatatc
atgtcaccgtctcccaagtctcccttggctacaccccctgtccaggagaaacctcgaccg
accgccagttcaattgcacacgacattttgagtgccgaattgcaagcacatcactcgccc
gaatgtgcaagccaaccgcaaacgatcgtggtcctcaacgatgccgtctatggtcaccga
ttctcccgaccgagaacctcccgggccgcccttggtacgattgtcgaacgcccggaaaga
ataaaggcagctgttttgggtatctcgacagcctatgtgcgcctgggtggacgacacagc
gagggagccttcccacctcatcccaggagggatgtcgaagacctgccagggattcccttt
cggatacacaagacggaacgcaaactctcactactatcaccggctgttgttaatgttcat
ggaacgaaatggatggaagaattgaagatgatgtgcgaggcggccgagtccaagcttgca
atgggaggcaaagaactccagaggccagagttgaaccgaggaacggagaaagcacccgaa
aagtttcatgaaggtgatttatacctctgctcggagtctcttaacgctatggagggtgcc
ctgggagctgtttgtgaagctattgataccgtcttcggtcctggacctcaacgtgcattt
gtgggagtgagacctccaggtcaccactgctctgcctcatacccttcgggattctgctgg
atcaacaatgttcacgtcggaattatgcatgctgtcctcaaccatggacttacacacgcc
gctatcattgactttgaccttcaccatggtgacggatcccaggccatcacctggcaacac
aacactcgagctaacgcggcggccaagaacgctgctgcgtggaagaagtcgtcagttggc
tatttcagtttgcacgatatcaattcgtatccgtgcgagatgggtgatgaggaaaaggtt
aagaacgccagcatctgcattgataatgcgcacggccagacagtttggaatgtccacttg
caatcatggaagacggaggaggagttttggcgactctatgagaccaagtatagcgttctg
ctggaaaagaccaggaactatctcaagaaccaggcagaacgacttcggcagtcaaaccag
atccccaaggccgccattttcttctcggctggttttgatgcgagtgagtgggagagcgca
ggaatgcagcgccatcaagtcaacgttccgaccgagttctacgcccggatagcccatgac
gtcatcaaactggccgctgaagagggactcgaggtcgatggtcgcatcatcagcgtcttg
gagggtggctatagcgacaaggctttgttctctggtattcttagtcacctcagtggtttg
gcggatgaccagacgtatgaacgagagccgcagaacctgggacgtcttggtgcggagatg
ggacacaagatcggagtgctcgcggaggaagacgatgagatggatacaaagccatcattg
gactctgttcacagctatgatccggcctggtgggcaagtccacggctggacgagcttgaa
gctatagttgcaggtcctggtggtcctgcagcgaagccacacaacaacacgcttcccact
tacttttctccgacacaggcatcaacggccagggttgcggatcctattaagatgcgccgc
agtctttccaacctgggtgcttcactatcacggcctccctcaccacccccaccagaggtt
ccctggacggttgcagcccacgagctcagcaagcttctcatccctgaaagtcgccagaca
gacagctgcaagcccgaggatttgaacgccgaggcaacacgggcgagacgagaccgccaa
tcattgcttctgggaattgaccctaaccctccggccccagcttcacgcccgacgtcacgc
atgtctttgcgcgagaggcggcccaagccagctcctccccctcagcccatcaaggacaaa
gcaccaaaagtattctacctctatatatacccagtgcggagagccagtcgacgtcttagc
gaggtaccgactactctcgcatccagggctacatcgcacacttcgtccggtaatgaagct
gaccttccggagggttctgaggcccctggtcctggctctccagtgagcaccagggcacct
cccggtggaggtcttcaggtgaagaagactcgaaaccccgtggctactcgtaaagagcct
gcacctagggcgcctcgaaccactaaaaaggttgctcctcccaccgcatcgcggccccct
acagcagctcaaaggatccacccatcaacgaggcctcaggcaaaggctggcccatctggt
gcaaccggcgatgatatcgatagcatcacaacagggatgaagaagatccgtatcaatctc
atcacccagtcccagaaggaagccagagagcgagctcgacttgaagctgaaaagcagtcg
ccggaaatcagaggccctgactcgggaaacatctctcccactcaggttgcagcccctgac
tctgagattcctacccctccggctacaatctccgacgacgacaatgtgtttattgcgtac
caacccgaaggccctacacccgtggctgttgctcagcaggaacctatcaaatggctcccg
cctaatgtgcaaacgccaactgcacaaacacctgctgcaacaccaagcccggtaaagaag
aacaacctctttcagtataccgagggtatcccctttgcgccacgacagggacagcatgcg
ggggagcagaagccgacagatgaaggtgtcaagtcagagccgcccgcttctgaatctgtt
caagaaattcctgaggctcctcaacagtag

DBGET integrated database retrieval system