KEGG   Nectria haematococca: NECHADRAFT_14316Help
Entry
NECHADRAFT_14316  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16
AA seq 307 aa AA seqDB search
SAALLAVSTNAQLWDKTIQTTYGPVKGFEYFNSSTTEKYFNTSTSSVTAYLGIPFAADTG
YQNRWKPPQPHEPWNETLLATSFGPACPSPKNPTSSEDCLSLNIWTNANSSSDNLPVLVW
NQGSGLSSDNPWWYGGGMAMRDVVFISFNRRDDAFGYLAHPDLNAEGLARDGFNTSGNYG
VLDFLEVLKWVQGNIANFGGDLERVTIAGESFGSSQVYHAVNSELFSGLFSGAISQSGIR
YPYDTLLAGLATSYVTMDDALFHGQNYTAFHNASSIAEMRELSMEELLVGSDVRLNGTWI
WWVTALS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
agcgctgccctgttggccgtctcaaccaatgctcagctgtgggataagacgattcagacc
acttatggtcccgtcaagggcttcgagtacttcaactcaagcacaaccgaaaagtacttc
aacacatcgactagcagcgttacggcatacctgggcatcccctttgcagccgacactggc
tatcagaatcgatggaagccaccacagccccatgaaccatggaatgaaacgctgctggcg
acctcgttcggtcccgcatgccctagcccaaagaaccccacgtcgagcgaggattgtttg
agcctcaacatctggaccaacgccaactcttccagcgacaacttgcccgtcctggtgtgg
aaccagggcagcggcctttccagcgacaatccatggtggtacggtggtggcatggctatg
agagacgttgtcttcatttcctttaaccgtcgtgacgacgcctttggctaccttgcccat
cctgatctcaacgccgaaggtcttgcgcgtgatggctttaatacgtcgggtaactacggc
gtgctagatttcctcgaagtactcaagtgggtgcagggcaatattgccaactttggaggg
gacctggagcgtgtcactattgctggcgaatccttcggctcctctcaagtctaccacgcc
gttaacagcgagctcttctcgggcctcttctccggtgcaatctcccagtctggcatccgc
tacccttatgacacccttttggctggccttgcgacttcatacgtcaccatggacgacgct
ttgttccatggacaaaactacacggcgttccataacgcgtcgagcattgccgagatgcgt
gagctgtcgatggaggagcttctcgttggctccgacgtgagattgaacggcacctggatc
tggtgggtaacggcgctatcg

DBGET integrated database retrieval system