KEGG   Nectria haematococca: NECHADRAFT_21972Help
Entry
NECHADRAFT_21972  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NECHADRAFT_21972
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NECHADRAFT_21972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 672 aa AA seqDB search
EFEDLYDNFVTAHRRPYHRESTWDKITQPSILLSVLIVAVTVGYNFYATSATLREWIQLL
GRCFWDALVAIVPERLLDVFDTPDTSTSNSTSKSMLHDDKSAHAAKSERLRRVMGLDSSR
GMMASVFQVRNRALSMTGGVLGLKLDGDHPPGLGNMDNSCYQNSILQGLSALKPLPDYLS
ACLEASDNEDIDRDVAQTLRTLINDLNDVSNYGRTLWTPGVLKSMSTWTQQDAQEYFSKI
LDDVDKSVAKALKIAQPRNPGLAAKVEKDDTAASEHSDDSGYQSLSSSGTLDNKLPRNPL
EGLLAQRVACIQCGHSDGLSMIPFTCLTLSLGLDKNRHDLYERLDAYSKVEAIENVECAK
CTLLKAQRLLSTLVERFRETGKTDEQLAEPLRRLEVVELALEEDDFEEKTLTEKCKISQQ
SKVSTTKTKQIVVARPPQSLAIHMQRSVFDPSTFNMMKNSAPVNYPMTLDLGPWCLGSTG
EPIPTSDPDAAAEDGEKWTSDPRKSMIAGDLGESRLTGPIYELRAVVTHYGRHENGHYIC
YRKYPRHNPPTKAVDGASSEPGDQVEEVSAKVQPKEDGEPEMDWWRLSDHNVSMVSEETV
LSLSPGVFMLFYDCVDPTMVLTEDVKMQDAGEVTNEVAVAVAVTDTPTEQTGKENQVEQG
VENQATNNKAEE
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gaattcgaggatctctacgacaactttgtgacggctcatcgaaggccctaccaccgcgag
tccacctgggacaagatcacccagccgagcatcctcctctcggtcctcatcgtcgccgtc
actgtcggatacaacttctatgcgacttctgctacactccgggagtggatacagttgctt
ggacggtgcttctgggatgctctcgtggccatcgtcccagagcgcctcctggatgtcttt
gataccccagatacttcgacttcgaactcaacctcgaaatccatgttgcacgacgataaa
agcgcccatgccgcgaagagcgagaggttgcggagggtgatgggcctggacagctccagg
ggaatgatggcctctgtgttccaggtcaggaatcgcgccctgtctatgaccggtggcgtc
ctgggcttgaaactagatggcgatcacccacctgggctaggaaatatggacaactcttgc
taccagaacagcatcctccagggattgtctgctttgaagcctcttcccgactatctctca
gcttgtctggaagcttccgacaacgaagatatcgatcgcgatgttgcgcagacattgcga
acacttattaacgatctaaacgatgtgtcgaactacggaaggacgctatggacgccgggt
gtcctcaagtcaatgagtacatggacgcagcaggatgcgcaagaatacttttcaaaaatc
ctcgatgatgtcgacaagagtgtcgccaaagccttgaaaatcgcccaaccacggaacccc
ggcttggccgccaaggtcgaaaaggacgatacagctgctagtgagcatagcgacgacagc
ggttatcaaagtcttagcagttcaggcacactcgacaacaagttaccacgaaatcctttg
gaggggcttcttgcgcagagagtggcatgcattcagtgtggacactcggacggtctgtcc
atgataccctttacttgcctaactctgagtctcggacttgataagaatcggcacgacctc
tatgagcgactagatgcttacagcaaagttgaggcgatcgaaaatgtggaatgcgccaaa
tgcacactcctcaaagcccagagacttttgagcacactggttgagaggttccgcgagaca
gggaaaactgacgaacagctcgcagagccgttgcgcagactggaagttgtggaattagca
ctggaagaagacgattttgaagagaagacgttgacagagaagtgcaagatctcacagcag
agcaaggtcagcacaaccaagacgaagcagattgttgtggcccgacctccccagagtctt
gcgattcacatgcaacgatcggtattcgacccttcgacatttaacatgatgaagaattcg
gctccggtcaactatcccatgacgttagatcttggtccttggtgtctcggtagtaccggc
gaacctatcccgacctctgaccctgatgcggctgcggaagacggggagaaatggacgtct
gatcccaggaaatcaatgatcgcaggcgacttgggggaatcgaggcttacaggacccatc
tacgagcttcgagcggtggtgacgcattacggtcgacacgagaatggacactacatctgc
tatcgaaaataccccaggcataacccgcctaccaaggcggttgatggggcctcttccgaa
ccgggcgaccaggtggaggaggtcagcgcaaaggtgcaacccaaagaggacggcgagccc
gagatggactggtggcggctgagtgatcataatgtgtcgatggtcagcgaagagacagtc
ctgagcctgtcacctggagttttcatgctgttttacgactgcgtggatcctacgatggta
ctcacagaggatgtcaaaatgcaggatgcgggcgaagtcacaaatgaggttgcagttgca
gttgcagtcacagataccccgacagaacagacagggaaggagaatcaagtcgaacagggg
gttgagaatcaagcgaccaataacaaagcagaggag

DBGET integrated database retrieval system