KEGG   Nectria haematococca: NECHADRAFT_31352Help
Entry
NECHADRAFT_31352  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
nhe  Nectria haematococca
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NECHADRAFT_31352
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NECHADRAFT_31352
Protein kinases [BR:nhe01001]
 Serine/threonine protein kinases: Other group
  TTK family
   NECHADRAFT_31352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 828 aa AA seqDB search
MAAASPTPMGNGLVRRTSQRQGLRRLPSRQAMNHNESYSAPATSSAPNGYHPKPQQFHDD
SSEDEIPVPMKLSALTKALLNDGAPESVERPPSPPRTRRRTSALNASTSSATETRRHLRS
GSVQAHDQRSSRPTSPAPASRDISPVRKRVVRLSNTPQSLNQMKPTKRRSTSVSRSTQRS
RPRSRPGSRDMSSDERHDSQQEINTPAQGGRVVRINAGSPSNRSRVGSTGPSSGRSMERS
VLDKSALDMDNDQPEEPATVARNPPPFHHGSSSMRIKRVGKVAGSFLSGPARRGRRRQSE
EDGEVNGDGEVMSSQEPESQPADDQHAPSYYGDGIRDFNSGSPVSAARAVHRRNASNLDL
RMEQNEEEEEEIHYRLPALPRPELPSGHDQENNAPPSYKRTKPSVDVLLDKIPKRPASVD
PAAMRAVSPERKPLASMARNTPLRHAPPPPPKMSVLEAATATAGAATTTQAKQRRNILRV
NGVAYTRLDCLGRGGSGKVYRVAAENGKMFALKRVSLENADDNTIKGYLGEIDLLKKLGE
VERVIKLFDCEMNTEKQILTLLMEIGELDFNTFLRKRYNPEAAKFDPVFVRFYWKEMLEC
LQAVHQCDIVHSDLKPANFVLVKGQLKLIDFGIANAIQTDETVNVHRETQVGTPNYMSPE
SLMDFNNPRGGRMPGRPKLMKLGKPSDIWSLGCILYQMVYGLPPFGHIANQMSRCQAIIN
WDHEIEFPSRGMGGMSVPPSLIRTMRRCLNREHHMRPTCEELLHESDPFLYPAELTDKAL
PIDEELLGRIIQSVVTRCRERMPTEAESVSVWPQAYWASVKKAMAGRM
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcctcacccacgcccatggggaatggcctcgttcggaggacctcacaacga
cagggcctcaggagactcccttcgagacaggccatgaatcacaacgagagctactctgct
cccgcgacctcgtccgcgcccaacggttaccacccaaagcctcagcaattccacgatgat
agctctgaagacgagatccccgtacctatgaagctcagtgctctcaccaaggcgctactg
aatgacggtgcccccgagtctgtcgagcgacctccatcaccccctcgaacaagaagacgc
accagtgctctgaacgcgtcgacctcctcagccacagaaacccgccgacacttgaggtcc
ggaagcgtccaggcccacgaccaaaggtcctcaagaccgacgagcccagcacctgcaagt
cgggatataagtcccgtcaggaagcgcgttgtccgtttgagcaacactcctcaaagcctc
aaccagatgaagcctaccaagcgacgatcaacctcggtgtctcgttcgacacaacgatcc
cggccccggagccgccctggcagtcgagacatgtcctctgatgagagacatgactctcag
caggagattaacaccccagcacaaggtggacgcgtcgtgcgaataaatgctgggtctcct
tcaaaccgaagccgcgtcggctccactggtccttcttcagggaggtcgatggaacggtct
gtgctggacaagtctgcccttgatatggacaatgatcagcctgaagagcctgccaccgtc
gcacggaacccccctccctttcaccatggcagtagctcgatgcgcattaagcgtgtcgga
aaggttgctggtagctttcttagcggaccagcccggcgaggtcgccgacgacagagcgag
gaggacggcgaggtgaacggagatggcgaggtcatgtcgagccaggagcccgagagtcaa
cctgccgatgatcagcacgccccgtcttactatggtgatggtatccgggactttaactcg
ggtagcccagtgagcgctgctagggcagttcatcgaaggaatgcctccaatctcgacttg
cgcatggagcagaatgaggaggaggaagaggaaattcactaccgcctccctgctcttcct
cgccctgagctgccttctggtcacgaccaagagaacaatgccccgccgagctacaaacgg
accaagccctcagttgatgtgcttctggacaagatacccaagcgacctgcgagtgtcgac
cctgctgctatgagggcagtttcaccagaacgcaaaccactggcatccatggcccgaaac
acacctcttcgccacgctcctccgccccctcccaagatgtctgttcttgaggctgccaca
gcaactgctggtgctgccacaactacccaggcgaagcagcgacgcaacatcctgcgagtt
aatggagtggcctacactcgacttgattgtcttggtcgtggtggtagtggaaaggtgtat
cgagtcgcggccgagaatggcaagatgttcgccctcaagcgagtctcgttggagaacgcc
gacgataacaccatcaagggctaccttggtgagatcgacctattgaagaagcttggcgag
gtggaacgcgttatcaagctgtttgattgcgaaatgaatactgagaagcagattcttact
ttgcttatggagattggagagctggactttaacacctttttgcggaaacgttacaacccc
gaagccgccaagtttgatccagtttttgtgcggttctactggaaggagatgctcgaatgc
ttgcaggcggttcaccaatgcgatatcgttcattctgatctcaagccggccaatttcgtc
ctggtcaagggtcagttgaagctcatcgactttggtattgccaacgctatccagacggac
gagaccgtcaacgtacaccgcgagacacaggttggcacacccaactacatgtcccctgag
tccctcatggacttcaacaacccccgaggaggccgcatgcccggacgacccaagcttatg
aagctgggcaaacctagcgatatttggtccctgggctgtatcctttaccagatggtgtac
ggtctgcctcctttcggccacattgccaaccaaatgtcaagatgccaggccatcatcaac
tgggatcatgagattgagttcccttcgcgtggcatgggaggcatgtccgtcccaccttcg
cttatccgcaccatgagacgatgcctcaaccgagagcaccacatgcgaccaacatgcgag
gagctgcttcacgagtcggaccccttcctttatcctgctgagcttaccgacaaggctctt
cccatcgacgaggagctgcttggtagaatcattcagagtgtggtgacgaggtgccgagag
cggatgccaacagaagccgagagcgtgagcgtttggccgcaggcttattgggccagcgtt
aagaaagccatggccggcaggatgtaa

DBGET integrated database retrieval system