KEGG   Nectria haematococca: NECHADRAFT_32477Help
Entry
NECHADRAFT_32477  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nhe  Nectria haematococca
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NECHADRAFT_32477
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NECHADRAFT_32477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 321 aa AA seqDB search
MASPASLPRITILGSLNMDLVAYVPHHPLPGETLTSNHFNTSPGGKGANQAVACGKLSRA
ADLTNASAVVSMVGAVGADPYGTLLLDSLRSFGVAVDAVAVRQDQKSGLAIIVVDEPSGQ
NRIILSPEANHSLRPSDFESLPGPRPDLLIMQLEIPFDTVIQALKAAKADGVPVLLNPAP
AQPLPEDAYEGLAHLVVNETEAAILADCAESELDDLDGLNRVGRVFIDRGVQNVIITLGG
RGVYYVNKGGKSALLPATKTTVVDTTAAGDTFVGSYALAVVAAHDGDFDIEAAVTTANRA
AAKTVSRKGAQISIPWKDELE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcccgctagccttccgcgcattaccatcctgggatccctcaacatggacctt
gtcgcctatgtgccacatcatcccttgccaggtgaaactctcacctcgaaccacttcaac
acgtcccccggcggcaagggcgccaaccaggccgtcgcctgcggcaagctctcacgcgcc
gctgacctgaccaacgcctcggccgtcgtctccatggtgggtgccgttggcgccgatcca
tacggtaccctcctgctcgatagcctccgctccttcggcgtcgccgtcgatgctgttgcc
gtccgccaagaccagaagtctggcctggccatcatcgtcgttgacgagccctctggccag
aaccgcatcatcctctcgcctgaggccaaccattctctccgcccctcggatttcgagtcc
ctccctgggccccgtcccgatcttctgattatgcagcttgagattccttttgatacagtc
atccaggctctgaaggctgccaaggctgacggcgtccctgtcctcctcaacccggctcct
gctcagcccttgcctgaggatgcctacgagggcctggctcatctcgtagtaaacgagacc
gaggcggccattcttgcagattgtgccgagtccgagctggacgacctcgatggcttgaac
cgtgttggccgtgtctttatcgacagaggagtccagaacgtcatcatcactctcggtggc
cgaggcgtctactacgtcaacaagggagggaagagcgcactgcttcctgccactaagacg
acagtggtggacaccactgctgccggtgacacctttgtcggttcctacgccctcgctgtt
gtagctgcacacgacggtgactttgacattgaggcggccgtcaccacggcaaaccgagcg
gctgccaagacggtctcacgcaagggtgctcagatctctattccctggaaggacgagcta
gagtaa

DBGET integrated database retrieval system