KEGG   Nectria haematococca: NECHADRAFT_32573Help
Entry
NECHADRAFT_32573  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NECHADRAFT_32573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_32573
  Lipid metabolism
   00071 Fatty acid degradation
    NECHADRAFT_32573
  Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_32573
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NECHADRAFT_32573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 364 aa AA seqDB search
MASLEVPAQQRAAIRQGVGPESTTSIKTIEVPKPGPGQILVKVNWSGLCGSDKSLLHNEW
KDFGLSMMDVTKGIAGHEGAGPVVAVGAGMEKRWKVGDRAGVKWIASTCGECEFCLNGVD
EVHCPNQTNSGFSVPGTFQEYVIADGRYTTKLPDGVLDEEAGPIMCGGVTAYAACKRSNV
KPGQWIVLPGAGGGLGHFAVQYAKAMGMRVIAIDGGDHKRELCKKLGAEVFIDFKETKDI
TAEIMKITKYGAHGVIVTAATRAAYESAPGFLRPNGTVVAVGLPQDSTIIAGCTPMTMAL
RRLNVVGSVVGNLKDVEEALDFTARGLVRPILSKGKLEDLDDWVHKLATGQVAGRCVLEV
TAQA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctcgaggttcccgctcagcagcgtgctgccatccgccaaggcgtcggccct
gagtcgaccacctccatcaaaacaattgaagtccccaagcctggccccggccagattctt
gtcaaggtcaactggtctggtctttgcggctcagacaagtctctcctgcacaatgagtgg
aaggactttggccttagcatgatggacgttaccaagggcattgccggccacgagggtgct
ggtcctgtcgttgctgtcggtgcgggcatggagaagcggtggaaagttggtgatcgcgct
ggtgtcaaatggattgccagcacctgcggcgagtgcgagttctgcctcaatggtgtcgat
gaggtgcactgccccaaccagacaaacagcggtttctctgtgcctggaacattccaggag
tacgtcatcgccgacggccgatacactaccaagctccctgatggtgtccttgatgaggag
gctggtcccatcatgtgcggaggagtcacagcttacgccgcttgcaagcgatcaaatgtc
aagcctggccagtggattgtccttcctggcgctggcggtggtctcggccactttgccgtc
caatacgccaaggccatggggatgcgagtcatcgccatcgatggcggagatcacaagcgc
gagctgtgcaagaagttgggtgccgaggtctttatcgacttcaaggagaccaaggacatc
acggccgagattatgaagattacaaagtacggagcccacggtgtcatcgttacagccgcc
actcgggcagcctatgagtctgctcctggattcctccgtcccaacggcactgtcgtcgct
gtcggccttcctcaggacagcaccatcattgctggttgcacccctatgactatggctctt
cgacggttgaatgtcgtgggaagtgtcgttggcaacctgaaggatgttgaggaggctctc
gactttaccgcccgaggcctcgtccgccctattctatcaaagggcaagctcgaggacctc
gatgactgggtgcacaagctggcgactggtcaagttgccggacgctgtgtgcttgaggtc
acggcccaggcttaa

DBGET integrated database retrieval system