KEGG   Nectria haematococca: NECHADRAFT_32861Help
Entry
NECHADRAFT_32861  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
nhe  Nectria haematococca
Pathway
nhe00790  Folate biosynthesis
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_32861
Enzymes [BR:nhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NECHADRAFT_32861
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NECHADRAFT_32861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 9668982
NCBI-ProteinID: XP_003046570
JGI: 32861
UniProt: C7Z7E0
Position
2
AA seq 472 aa AA seqDB search
MPGLKRSACGCACSCGSGNSGPRKTTAYIALGSNMGDRVAEIERACNEMDRRGIKVKRTS
SLWETEPMYVTDQDRFVNGACEVETELEPMALLDQLQAIENEMGRKKVIDKGPRNIDLDI
LLYGDEMVDNERLRVPHIGILEREFVLRPLAELIPAKSLDPSKPWKLIQDHLNELPLGEP
LSSMTPLSPSSSPLTPLARKRKTHIMGILNLTPDSFSDGGVHAQDSIAQTVINMVRDGTS
IIDVGGQSTAPGRPEVSADEEISRVVPAVQLIRSIPEARDVVISIDTYRASVAEQAIASG
ADMINDVSAGVLDADMLPTVARLDKTICLMHMRGTPQTMTELTSYPDGLIPTVASELLSR
VAAAEAAGIRRWRIVLDPGIGFAKTASQNLELLRRLEELRYWPGLEGLPWLVGSSRKAFV
GRITGVTEPARRTWGTAATVAAAVQGGADVVRVHDTAEMGAVAKMSDAIWRF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcctggactgaaacgctcggcctgcgggtgtgcgtgctcgtgtggtagcggcaatagc
gggccgcgcaagacgacggcgtatatcgctttggggagcaatatgggtgaccgcgttgca
gagattgagcgtgcttgcaacgagatggaccgtcgaggcatcaaggtcaagaggactagt
agtctttgggagacggagcccatgtatgtgacggaccaggaccgcttcgtcaatggagct
tgcgaggttgagaccgagttggagcccatggctctgctcgatcaactacaagccattgag
aatgaaatgggtagaaaaaaggtcatagacaagggcccacgcaacattgacctagacatt
ctcctatacggtgacgaaatggtcgacaatgagcggctcagggttcctcacatcggcatc
ctggagagggagtttgtcctcagacccctggccgagctcatccccgcaaagtcattggac
ccctccaagccgtggaagctcatccaggaccatttgaacgagttgcctcttggcgagcct
ctgtcgtccatgacacccctctcaccgtcttcgagtcccctgacaccactcgcgcgcaag
agaaagacgcatatcatggggattctcaacttgacgcccgactcgttttctgacggcggg
gtgcatgctcaggatagtatcgctcagacggtcatcaacatggttagggacggcacgtct
attatcgatgtcggcggccagtctactgcgcctggccgacccgaggtttcagctgacgag
gagatatcccgcgtggtgccggcagtgcagctcatccgttccatcccagaggctcgcgat
gtagtcatcagtatcgacacgtatcgggcgtcggtagctgagcaggcgatagccagcggt
gcagacatgatcaacgatgtatcagccggtgtgctcgacgccgatatgctcccgactgtg
gcccggctcgacaagaccatctgtctgatgcacatgcgcgggacgccgcagaccatgacg
gagctcacatcgtacccggacggacttatcccaacggtggcgtcggagctcctttcacgg
gtggcggcggccgaggcggcggggatccggcggtggcggatagtcctcgacccgggcatc
ggcttcgccaagactgcatcacagaacctcgagttactccgacgtctcgaggagctgaga
tactggcctggtctcgagggtctgccgtggctagtaggatcaagccgcaaggcctttgtc
gggaggatcacgggagtgacggagccggctcgacggacgtggggcacggcggctacggtg
gccgcggcggtgcagggcggggccgacgtggtgagggtgcacgacacggccgagatgggg
gcagtagccaagatgtcggatgcaatctggaggttttga

DBGET integrated database retrieval system