KEGG   Nectria haematococca: NECHADRAFT_32956Help
Entry
NECHADRAFT_32956  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
nhe  Nectria haematococca
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NECHADRAFT_32956
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     NECHADRAFT_32956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 438 aa AA seqDB search
MQTSGNKTVLVRRLKRKEESTWKHLARWFVENQIGLSFNLLALIFLAQTFIPKAREHTYK
FFNLSYYNPKSGQYRIGFDDAYFIAFCIILFTGLRAGIMEHVLAPIGRFQGITNRKSLTR
FSEQAWLMVYYTVFWPWGVYIYCTSPHYMSMKNLWTDWPNRELDGLMKGYLLCQWAFWLQ
QMIVINIEERRKDHWQMFTHHIVTTALIYSCYAYHHTRVGNFILVIMDVVDLFLPLAKCL
KYSGFTKLCDVMFGLFVVSWFIARHVLYIMVCWSIYSDVPQIMPTGCFKGTNDNLIGPID
PPAGYSYLLDPFLKPDGLVCYNEIIQWAFLGPLLFLQLITIGWFTLIVRVIIKVLKGGDA
EDVRSDDEGGDEEEEEDEFVYEEAQPLEEEVGVEDLDLRNWERRSGVRKQASSSGVSLPG
HSDRKELLGRIGCEKQVD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctcgggcaacaagacggtgctcgtccgtcgactcaagcgcaaggaggagagc
acctggaagcaccttgcgcgctggtttgtcgagaaccagattggcctttcgttcaatctc
ctcgccctcattttcctcgcccagacctttatccccaaggcccgcgaacacacgtacaag
ttcttcaacctcagctactacaaccccaaatcaggccagtaccgcatcggattcgatgat
gcctacttcatcgccttttgcatcatcctttttaccggcctccgcgctggcatcatggag
cacgttctggcccccattggcagattccagggaatcaccaaccgcaagtccttgactcgc
tttagcgagcaggcctggctcatggtgtattacactgtcttttggccctggggagtgtac
atttactgcacctcgcctcactacatgagcatgaagaacctctggaccgactggcccaac
cgcgagctcgatggcctcatgaagggttacctcctatgccagtgggctttttggctgcag
cagatgattgtcattaacattgaggagcgtcgcaaggatcactggcagatgtttactcac
cacattgtcacgactgcgctcatctactcttgctacgcctaccaccacacccgcgtcggc
aactttatcctcgtcattatggatgttgttgacctgtttctccctcttgccaagtgcctc
aagtacagcggcttcaccaagctctgcgatgtcatgtttggactgtttgtggtttcgtgg
ttcattgcccgccacgtcctctacatcatggtctgctggtccatctacagcgatgttccc
cagatcatgccaaccggctgcttcaagggcaccaacgacaacctgattggccccatcgat
cctccggccggctattcatacctactcgaccccttcctcaagcccgacggccttgtctgc
tacaacgagatcatccagtgggctttccttggtcctctcctcttcctccagctcatcacc
atcgggtggttcaccttgattgtccgtgtcatcatcaaggtcctcaagggaggtgatgcc
gaggatgtgcgaagtgacgacgagggtggtgatgaggaagaggaggaggatgagtttgtt
tacgaggaggctcagccccttgaggaggaggttggcgtcgaggatcttgacctcaggaac
tgggagcgccgatctggcgttaggaagcaagccagcagctccggagtcagcctccccggc
cacagcgatcgcaaggagttgctgggacgtatcggttgcgagaagcaagtcgattag

DBGET integrated database retrieval system