KEGG   Nectria haematococca: NECHADRAFT_34492Help
Entry
NECHADRAFT_34492  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     NECHADRAFT_34492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 608 aa AA seqDB search
MFLYIHLRHLLLALFLGINAVLGTSNFNPQILADTNRDGIINHLDAANKHTWTSSRGAIF
LPNIGDQQHRCPDVDLVKQPLSNFELAACNDASGDRLLTPEYAAPLKTLPLKNLSQNAIG
SIYTTPKSALGRVRIFWQSPDSEWSLVDPQITFNATSLAAGLTLAIDGRELVTDSSIWDG
LVNITFSVTDGNTTASDTVAMKQAPVLIHHHLQAPEVVLSTDGSITTSTWQTGFINSVQN
ALENLDQDIPLFLFNETDDIWAQDFLEPGYASMPGPNGPISIRVLLRSPQSGRAAGRQVF
SLLRGPEIGGFQPGLGSGFGHEEINSGGNFETIPPYTSRAGVEYKSGRVITGKHFDKYPA
ESMIKFLEAQGVQKPLVLETGWLAVGHVDELVQFVPYDNELGFTIAVVDTASAFSLLQEA
WKDGHGDTKVISYDGDMTPDNETIFIDPEVRNLTIKDLLSDKDFVAINAYAQSFINDTLD
LLLEEVPLTESDILRVPTLWKDVTYPWPKTPDGHPLRLNRAPPGERQVKSFFPQSINGLV
LGHDCLAPKPWGPVINGRDILEDAVKDVYARANMTVWLIDDYMSHHVRGGEVHCGTNTLR
EKDVAWWE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtttttatatattcatcttcggcatttattgctggctctttttctcggcatcaacgcc
gtactgggcacatcaaatttcaacccacagattctggccgacaccaaccgtgacggcatc
atcaaccatctcgacgctgcaaacaagcacacatggacttccagccgtggcgcgatattc
ctcccaaacataggagatcagcaacatcgctgcccagatgtcgaccttgtgaagcaacct
ctcagcaactttgagctggcggcctgtaacgacgcatctggagaccgcctcctcacccct
gaatacgcagctcctctcaagactcttccactgaagaacttgagccagaatgctattggt
tctatctacactactcccaagtccgcccttggccgtgttcgaattttctggcagagtcca
gattcagaatggtccttggtcgaccctcaaatcaccttcaatgcgacgagccttgcagca
ggcctcacactggccatcgacgggcgagaactggtgactgactcttcaatctgggatgga
cttgtaaacatcacattcagtgtaactgatggaaatacaaccgcaagcgacactgtggct
atgaaacaagcccccgtgctcatccatcaccacttgcaagccccagaagtggtcctcagc
actgatggaagtatcaccacttctacctggcagactggcttcatcaactccgtccaaaat
gccctcgaaaatcttgaccaagacattccgttgtttcttttcaacgaaacggacgacatc
tgggcccaggactttctcgaacccggatatgcaagcatgcccggccccaacggaccaatc
tccatccgtgtactcttgcgatctcctcaatcaggccgtgctgcaggacgccaagtcttt
tctcttttacggggtcctgaaatcggtggtttccagccaggtctcgggtcaggctttggt
cacgaggagatcaattctgggggcaactttgaaaccatcccaccatacacctcaagagca
ggagtcgagtacaagagcggacgagtcatcacaggcaagcactttgacaaatatccagca
gagtcgatgatcaagtttttggaagctcagggtgttcagaaaccattggttctcgagact
ggatggctggctgttggacacgttgacgaattggttcaatttgttccatacgataacgaa
cttggcttcaccattgccgttgtcgatacggcttcagcgttcagtctcttacaggaagcc
tggaaggatggtcatggtgatacaaaggtcattagctacgacggggacatgacacccgac
aacgagaccatctttatcgatccagaggtccggaatcttacgatcaaggatttgcttagc
gacaaagactttgtcgccattaatgcctacgcacagagcttcatcaacgacaccctcgac
ctcctccttgaagaagttcccctgaccgagtcggatatcctccgcgtccccacgctctgg
aaagacgtcacctacccttggcccaagaccccagatggccatcctctgcgcctcaacagg
gctcctccaggagaacgacaagtcaaatcgttctttccgcagtctatcaacgggctggtc
cttggacatgactgcctggcgcccaagccgtggggccctgtcattaatgggcgggatatt
ctcgaggatgctgttaaagacgtgtatgccagggccaatatgacggtttggctgattgat
gattacatgtctcatcatgttcgaggcggagaggttcactgcggaacgaatactttgagg
gagaaggacgttgcatggtgggagtaa

DBGET integrated database retrieval system