KEGG   Nectria haematococca: NECHADRAFT_34817Help
Entry
NECHADRAFT_34817  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     NECHADRAFT_34817
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     NECHADRAFT_34817
    3.1.1.84  cocaine esterase
     NECHADRAFT_34817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 528 aa AA seqDB search
MHTYVVFPTVFGLLCSVARAVLYESVIQTPSGPVQGYPAFNSTIAGLNLTNWQKVTVWKG
IPFAADTSGENRFRPPQKVTAWNITLDAKDYGYSCPSSGTTYATIGEDCLNVNVWSAANS
TDDKLPVVLWSYPAGGSNADPRFDGAGLADKGVVFVNYNYRTGPTGWLVSPELTEENLAT
IGLNSSGNWGMLDQFAALQWVRDNIASFGGDPDHITVMGQSAGSAATYHILNSPLTKGKI
VGAIIQSGLRDPHDPSAVELAEGYQTYDVAEEYGLSFMESVNCSTISCMRSLPMETLDTS
ERGGTAGASFKGTLDYYCMPDTYLNTLKLGLAHDVPILTGNTRDESGASYGLNITLAEYL
SGLNSTYTNGFADKFFDAYPANNSTTASAAQNAQYTDRSTVGTQFWANYWLSNRTSPVWT
YLWDHAPPGQNAGAAHMTEIQYTQYNLYNVYYGEWEEEDYEIAEKMSNYWVNFIKYGNPN
GDGLTYWDNVNASTTTTQELGGGWGPKIIARDDQIALFKSWFASLAAI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcacacatatgtcgttttccccactgtctttgggttactttgttcagtcgctagggca
gtcctatatgagagcgtgatccaaacccccagtggccctgtccaaggttatccggccttt
aacagcactattgccggtctgaatctcaccaattggcaaaaagtcactgtctggaaaggc
atcccctttgctgccgacacgtcgggggaaaaccgcttccgtcctcctcaaaaagtcaca
gcttggaacataactttggacgccaaggactatggctattcttgtccatcgtctggcacc
acctatgccacgattggtgaagactgtttgaacgtcaacgtttggagcgcagccaactct
acggatgacaagctgcctgttgtcctgtggagctaccctgccggcggctctaacgctgat
cctcgcttcgatggtgctggattggctgacaagggcgttgtttttgtcaattacaactat
cgtactggcccaaccggttggcttgtgtcccccgagttgacagaggagaacctagccacc
atcggcctcaacagctctggaaattggggcatgctagatcagtttgctgctctgcagtgg
gtgcgagacaacattgcctcctttggtggtgaccctgaccacattacagtcatgggtcaa
tcggctggttctgctgcgacctatcacattctcaacagtcccttgaccaaaggcaagatt
gtcggcgccattatccaaagtggtcttcgtgatccccacgatccatccgctgtcgagctg
gctgaaggctaccagacctacgacgtcgccgaggaatacggcctctcctttatggagagt
gtcaactgttccacgattagttgcatgcgctccttgccaatggagaccctcgatacttct
gagcgtggaggcacagctggcgcatcattcaagggaaccctcgactattactgcatgcct
gatacttatttgaacacgctgaaacttggtctagctcacgatgttcccatcctgacaggc
aacacaagggacgaaagtggcgcttcttatgggttgaacatcacacttgcagaatacctt
tcgggtttaaacagcacatatacaaacggatttgcggacaagttcttcgacgcttatccg
gcaaacaactccaccactgcttccgctgcccaaaatgcacaatacactgatcgttccacg
gttggcacacagttttgggccaactattggttgagcaacagaaccagcccggtatggacc
tatctttgggatcacgctcctccaggacaaaacgccggcgctgcccacatgacggaaatt
cagtatacgcaatacaacctctacaatgtatactacggtgaatgggaggaagaggactat
gagattgctgaaaagatgagcaattactgggtaaactttatcaaatacggcaaccccaat
ggcgatggtttgacttactgggacaatgtcaatgccagcacaaccacgactcaggagctt
ggtggcggttggggccccaagatcattgcacgtgatgatcaaattgctctcttcaagtcc
tggtttgcttcgttagcggctatttaa

DBGET integrated database retrieval system