KEGG   Nectria haematococca: NECHADRAFT_35365Help
Entry
NECHADRAFT_35365  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NECHADRAFT_35365
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   NECHADRAFT_35365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 229 aa AA seqDB search
MSTTPGVSYKNGKKVFIPLENNPEVFNKLIHNLGVSEKLGFYDVYSVDEPDLLAMIPRPV
HALIFITPTPMYYRVRENDPGSEELTYDGSGPNEPVTWYKQTIGNACGLIALLHSQALPL
KPLPRADLLYNSAELEKAHMAAAVTGDTVAPASQEPVGYHFISFVKGENGHLYDLEGGWG
GPIDRGVLADDEDLLSDKALEATVKKFTNAADGNLEFSIIALATVPDEN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccactcccggagtctcgtacaagaacggcaagaaggtcttcatcccgctcgag
aacaaccccgaggtattcaacaagctcatccacaatctcggcgtgtctgagaaactcggc
ttctacgatgtctacagcgtcgatgagccagacctgctggccatgattccccgccccgtc
cacgctctcatcttcataacccccacgcccatgtactaccgcgtgcgcgagaatgatcct
ggctccgaggagttgacctacgacggctccggccctaatgagcccgtcacttggtataag
cagactatcggcaacgcttgtggtctcattgctcttctccacagccaagctctccctctc
aagccactaccccgtgccgaccttttgtacaattctgccgagctggagaaggctcacatg
gccgccgcagttacgggcgataccgtggcccctgctagccaggagccagttggttaccac
ttcatcagcttcgtcaagggggagaacgggcacctgtatgatcttgaaggaggctgggga
ggccctatcgaccggggcgtgctggctgatgacgaggatctcctcagcgacaaggcgttg
gaggctactgttaagaagtttaccaatgccgctgatggaaacctcgagttcagcatcatc
gctctggcgactgtgcccgatgagaattag

DBGET integrated database retrieval system