KEGG   Nectria haematococca: NECHADRAFT_35408Help
Entry
NECHADRAFT_35408  CDS       T01612                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nhe  Nectria haematococca
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_35408
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NECHADRAFT_35408
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NECHADRAFT_35408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 946 aa AA seqDB search
MAHSNDDADLDPIWQDLDRAIGQILIMGWDGTEVTPQIRSLIEDHHLGSIILTAKNLKSA
QQTAELVQELQTIAKNAGHPQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADL
AYEVTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIR
DAGIASCGKHFPSYGNLDFLGSNLDVPIITQTLEELSISALVPFRNAIGSGKLDAMFIGG
CGISNPSMSVSHACLSDQVVDDLLRDELGFNGVAISECLEMEALSHELGVQNGVVMAVEA
GCDLVLLCRAYDVQLEAIKGLKLGYENGIITKERIFTSLRRVLQLKSTCTSWNKALNPPG
ISLLSQLHPSHLALSLRAYDDSITVIRDKEKLLPLSASMHPGEELLLLTPLVKPLPASSL
TKKLLSTKGDQSQAWGSHHIWAHNDRDRSAIMSGEGVFREFGKSLARARNEKLLHTSYTA
NGVRPVHENLIHRASCIIIVTADANRNLYQAGFTKHVDMMCAMLRSRGQKKQLIVVAVSS
PYDFAMDKSIGTYLCTFDFTENALHALARALVGDITPLGTLPGTLRKSKKVLKSRQHWLV
EEYHTDRDASGLEDLIRAIHRASAPDLQFLRTTTAATFQLKNPNIAEAHVVVRNSSTGAL
YGFAATYFLHGVGILAAIFVDPSKRDVSIGRSLHRRALRSLMQRRGIKKVQLGSAFPGVF
LGIPVDIEVNTVKEWFSNSGWDVQFPRRVTNMIIQDLPNWSAPEGLLQSIQRANISFDLI
HGLDNGDGVLSHVRTHANAEILELYRYALSDNKSCGIVRAKDATGNLLGTIIISKQHGSL
ATHVPALLSHTEDISGILAPIVPAMPQSNLVLQGLALMGVRQSKGHKAAKVVLGWVVDDG
TEPLAAMGFESLQAFEEITNSPENVSNKPDLYLKHYLIMQQFSNLG
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggcccatagcaatgacgacgccgacctggatccgatatggcaggatctcgaccgtgcc
attgggcagatcctgattatgggttgggatggcactgaagtcaccccccagatcaggagc
cttatcgaggatcaccatctcggctccattatcctcactgccaagaacctcaagtctgcc
caacaaactgctgaacttgttcaagaactacagactatcgccaagaatgcgggtcatcca
caacccctgttgattgctcttgaccaagagaatgggggcgtcaacagtctatttgacgag
gactatgtctgtcaattcccaagtgcaatgggagttgcggccacaggtcgagcagacctt
gcctatgaagtcaccaaagctacggcaactgagatctctgcttgtggtgtgaacctcatg
ctaggtccagttcttgatgtcttgaacaacgctcgctaccaacctctgggagttcgcgca
acgggagacgacccgcaggaagtatctcagtatggtcttgctgccctgagaggaatccgt
gatgcagggatagcttcctgcgggaaacacttcccttcatatggaaacttggactttctt
ggttcaaatctagatgttcccattattacccaaacactggaagaactgagcataagtgct
ctggttcccttccgaaacgccattgggtctggcaagttggatgccatgttcatcgggggc
tgcggtatatccaacccgtccatgagcgtgagccatgcttgtctatccgaccaagtggtg
gatgacctgctccgcgatgagctcggtttcaacggcgttgccatctcagaatgcttggag
atggaggccctcagtcatgaacttggtgtacagaacggtgttgtcatggcagtggaggcg
ggctgtgatctggtcctcctctgccgtgcctacgatgttcaactcgaagctatcaaggga
ttgaaactgggctacgagaacggcatcatcaccaaggagagaatctttacttcgctgagg
agagttcttcagctcaagtcaacttgcacatcttggaacaaggcactgaaccctccaggc
atttccctcctctctcaacttcacccatcccatcttgccctatcactccgcgcctatgat
gactccatcactgtcattcgggacaaggagaagctactccccctctctgcctcaatgcac
ccaggagaagaattacttctactcacgcccttggtcaagccacttcccgcatcctctctg
accaaaaagctcctcagtaccaagggcgaccaaagccaagcgtggggttctcaccacata
tgggcacataatgaccgagaccgcagcgccatcatgagcggagagggtgtgtttcgagag
tttggtaaatctcttgcgcgagcccgcaacgaaaagttgctccataccagctatacagcg
aatggagtacgcccagtgcatgaaaacttgatccatagggcatcttgtatcattattgtc
acggctgatgccaaccgaaatctctaccaagctggctttaccaagcacgtcgacatgatg
tgcgcgatgcttcggagtagaggccagaagaagcagttgatcgtggtggcagtcagttca
ccctacgactttgccatggacaagtcaattggcacgtacctctgcacctttgactttacg
gagaacgctctgcacgctcttgcaagggcacttgtgggagatattacacctcttgggacc
ctaccgggcaccttgaggaagagcaagaaggtcctcaaatcaagacaacactggctcgtt
gaggagtatcacacagaccgtgatgcctctggcctagaagatcttatacgagctatccac
cgagcaagtgcaccagatctacaattcctacggaccacaactgctgcaacctttcaactc
aagaaccccaacatcgctgaggctcacgtggttgtgagaaacagcagcacaggcgctctg
tatggcttcgctgccacctactttttgcacggagttggcatcttggcagcgatctttgtt
gatccttctaaacgggatgtatccatcggtagatccctccatcggcgggcgctcaggagt
ctcatgcagcggcgcggtatcaaaaaggtccaacttggctctgcctttcctggcgtcttc
ctgggaatccccgtcgacattgaggtgaataccgtcaaggagtggttctcaaacagcggc
tgggatgtgcaattccctcgaagagtcaccaacatgattatccaagacctccccaactgg
tctgccccagagggtctactacagagcatacaacgggccaacatcagctttgacctgatt
cacggtctggacaacggggacggtgtccttagccacgttcgtacgcacgccaatgcagag
atccttgagctgtatcgatacgctctatccgacaacaagtcatgcggaattgtgcgtgca
aaggacgcgacgggcaatctactcggcactattattatctcgaaacaacatggctctctg
gcaacacacgtaccagctctgttgtcccatactgaggacatcagtggtatccttgcacca
attgtcccagcaatgccacagtcaaacctcgttttgcaaggcttggcactcatgggtgtc
cgccagagcaagggtcacaaggcagccaaggttgttttgggctgggttgtggatgatggc
actgagccgctggctgccatgggattcgagtcgcttcaagcttttgaagaaatcactaac
tctccagagaatgtaagcaacaagccagacctttacttgaagcactatctaatcatgcag
cagttttcgaatcttggatga

DBGET integrated database retrieval system