KEGG   Nectria haematococca: NECHADRAFT_36044Help
Entry
NECHADRAFT_36044  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:nhe03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 338 aa AA seqDB search
MDNLWARRTNSGKLSLSTPGQGSSGDSFSRNASFPKRQGGDTPSSSKQNPFNTTPGGLVS
PTSGASSAFGLGSGAFASFGSAKTPKSSANPFDSAMGTAVAKSGQPKDLSKVVGKAPSMA
SISEGSQGAAAAAPVSHQLMEPWTFWYRPPISKAHGFIEYEKTLHEIATVRTVEEFWEIF
SYLKRPSSLPVVSDFHLFKKGVRPIWEDDVNKKGGKWVVRMKKGVADRYWEDLMLSLIGD
QFGDAGEDVCGAVLSVRNGEDILSIWTRTDGGRVIKIRETMKHVLNFPPNTRVEFKSHDS
SIQQRTAIEEQRREKAGQHHHHDKRHTGGVSKQPSEQS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctgggcccgccgcacaaactccggcaagctctccctctcgacacccggt
caagggtccagtggtgattccttcagtcgcaatgcttcctttccaaagcgccaaggcggc
gataccccgtcgtcgagcaaacagaaccccttcaacactacacctggcggcctggtctcc
cccaccagcggtgcctccagcgcctttggtctaggctctggagctttcgcctcctttggg
tctgcgaaaacacccaagtcctcggccaatcctttcgactcggctatgggcaccgcggtt
gcaaagtctggccagcccaaggacttgtcaaaggttgtggggaaggcccccagcatggcc
tccatctctgagggttcccagggggccgcggcggccgctcctgtatcacaccagctcatg
gagccctggactttctggtaccgacccccgatttccaaggcccacggcttcatcgaatac
gagaagaccctgcacgagattgctactgtgcggacggtggaggagttttgggagatcttt
tcctacctgaagcgcccctcctcgcttccggtcgtgtcggacttccatctcttcaagaag
ggcgtccggcccatctgggaggacgatgtgaacaaaaagggtggcaagtgggttgttcgg
atgaagaagggcgtggccgaccggtactgggaagacctcatgctctccctcattggggat
cagtttggtgacgctggagaggacgtttgtggtgccgtgctcagtgtaaggaatggagag
gacattctgagcatctggacccgaacggatggtggccgcgtcattaagattcgtgagacc
atgaagcacgtcctcaacttccctcccaacactcgagtggaattcaagagccatgactct
agtatccagcaacgaacggctatcgaggagcagcgccgcgaaaaggcgggacagcaccat
caccacgataagcgtcacacaggtggcgtgtcgaagcagccctcagagcaatcctag

DBGET integrated database retrieval system