KEGG   Nectria haematococca: NECHADRAFT_36117Help
Entry
NECHADRAFT_36117  CDS       T01612                                 

Definition
glycosyltransferase family 39
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
nhe  Nectria haematococca
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NECHADRAFT_36117
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     NECHADRAFT_36117
Glycosyltransferases [BR:nhe01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NECHADRAFT_36117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 950 aa AA seqDB search
MARSRGKSPRPPVKAEQPPAAVASKPKKSNTNGKAKNSTSYKSDGVEDNDVFLLPVSDYW
IVLGLMVVATIVRVYRIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKMLIALTGW
LAGFDGSFDFKEIGKDYIEPGVPYVAMRMFPAICGILLIPCMFLTLKAVGCRTMTAAMGS
GLIIFENGLLTQARLILLDSPLVAATAFTVLSFTCFTNQHELGPDKAFQLSWWFWLINTG
LGLGLTASIKWVGLFTIAWVGALTLVQLWVLLGDTKNVTMRLWTKHFMARVFSLIVVPLT
FYMAMFAIHFVALKNPGDGDGFMSSEFQATLNNKRMKDVPADVIMGSRVTLRHVNTQGGY
LHSHPLMYPTGSKQQQITLYPHKDDNNIWLLENQTQPLGVDGQPINGTYAWDALPEPQYI
KDGAVLRLYHRPTHRRLHSHDVRPPITEADWQNEVSAYGYEGFDGDANDFFRVEIVKKKT
KGAVAKTRLRTIETKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCARGGTLPNSLWYIE
SNAHPQLEGDVEKVNYRRPGFFGKFWELHKVMWRTNAGLTDSHAWDSRPESWPILRRGIN
FWGRQHTQVYLLGNPIIWWSSSVAIAIWVVFKGIAVLRWQRSCNDYSSATFKRFDYEIGT
SVLGWALHYFPFYLMKRQLFLHHYFPALYFAIIALCQVFDFITARVPGIGVRESNAINRI
ATVAFLVLSAAVFSLYAPLAYGSPWTKAECKRVKLFKTWDFDCNTFYDSYDKYSQVPAVS
SSVVPTTQATKKVDPVKQEAPVVEKQEQAVISGAPEPAVEHRVVAKEEKVEYRDQDGNLL
DPEQVKALEGKVEFKTKYETKIRVVDENGQELQEPEGGWPADIDAGVAPPHPDVEGVNSE
TLKGKEKVEEVVAAPAPEDVAASKDGEKEAEEAKAKPASENQDATVKDEL
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttcccggggcaagagtcccaggccgccggtcaaggctgaacagcctcctgct
gccgtggctagcaagcccaagaagagcaacaccaacggcaaggccaagaactcaacctcg
tacaagtcggatggtgttgaggacaacgatgtcttcctcctccccgtctccgactactgg
attgtcctcggcctgatggtcgtggccaccattgtccgtgtctacaggatctaccagccc
actagtgttgtctttgatgaggtccacttcggcggctttgctaccaagtacatcaagggc
aagttcttcatggatgtccaccctcccctggccaagatgctcatcgccctcaccggctgg
ctcgctggcttcgacggaagcttcgatttcaaggagattggcaaggactacattgagccc
ggcgtgccatatgtcgccatgcgcatgttccccgccatctgcggtatccttctgattccc
tgcatgttcctgactctcaaggctgttggctgccgtaccatgactgctgccatgggttcc
ggtctcattatctttgagaacggtcttctgacccaggcccgtctgatcctcctcgattcg
cctcttgttgctgccaccgctttcactgttctgtccttcacgtgcttcaccaaccagcac
gagcttggtcctgataaggccttccaactcagctggtggttctggctcatcaacactggt
cttggtctgggccttaccgccagcatcaagtgggttggcttgttcaccatcgcttgggtt
ggcgcccttactctggtccagctctgggttctgctcggcgacaccaagaacgttaccatg
cgtctttggaccaagcatttcatggcccgtgtcttttccctgattgtcgtccctctgacc
ttctacatggccatgttcgccattcacttcgttgccctcaagaaccctggtgatggtgat
ggtttcatgagctccgagttccaggctaccctcaacaacaagcgaatgaaggatgtcccc
gccgatgtcatcatgggcagccgtgtcaccctgcgtcatgtcaacacccagggtggctac
cttcactctcaccctctcatgtaccccaccggcagcaagcagcagcagatcactctgtat
cctcacaaggacgacaacaacatctggctcctggagaaccagactcagcccctcggtgtc
gatggccaacctatcaacggtacttatgcctgggacgctcttcccgagccccagtacatc
aaggacggtgctgttctccgactctaccatcgccctacccaccgccgcctgcactcccac
gatgtccgtcccccgatcaccgaggccgactggcagaacgaggtctcggcctatggctat
gaaggtttcgatggtgatgccaacgatttcttccgtgtcgagattgtcaagaagaagacc
aagggtgctgtcgccaagacccgcctccgaaccattgagaccaagttccgtctcgtccat
gtcatgactggttgtgttctcttctctcacaaggtcaagctcccagattgggcttccgag
cagcaggaagtgacttgcgctcgtggcggtactctccccaacagcttgtggtacatcgag
agcaacgctcatccccagctggagggcgatgttgagaaggtcaactaccgacgacctggc
ttctttggcaagttctgggagcttcacaaggtcatgtggaggaccaacgctggcctcact
gactctcacgcctgggactcccgccctgagtcttggcccatccttcgccgaggtatcaac
ttttggggccgccagcacactcaggtctacctcctcggaaaccccatcatctggtggtct
tccagcgttgccattgccatctgggtcgtcttcaagggcattgctgttctccgatggcag
cgcagctgcaacgactactcgagcgccaccttcaagcgattcgactacgagattggcact
tcggtcctcggctgggctctgcactacttccctttctacctgatgaagcgtcaactgttc
cttcaccactacttccctgctctctactttgccatcattgccctctgccaggtctttgac
ttcatcactgctcgcgttcccggcattggtgtccgtgagagcaacgccatcaaccgcatc
gccaccgttgctttccttgtcctctccgctgctgtcttctccttgtacgctcctctggcc
tatggtagtccctggaccaaggctgagtgcaagcgcgtgaagctcttcaagacctgggac
tttgactgcaacaccttctatgatagctacgacaagtacagccaggttcccgctgtcagc
tcctccgtggttcccaccacgcaggctactaagaaggttgaccccgtcaagcaagaggct
cctgtcgttgaaaagcaggagcaggctgtcatctctggagctcctgagcccgcggttgag
caccgtgtggttgccaaggaggagaaggttgagtaccgtgaccaagacggcaacctcctt
gaccctgagcaggtcaaggctctggagggcaaggttgagttcaagaccaagtacgagacc
aagatccgagttgttgatgagaacggtcaggagcttcaagagcctgagggcggctggcct
gccgacattgacgctggtgtcgcccctcctcaccctgatgttgagggtgtgaacagcgag
actctcaagggcaaggagaaggtcgaggaggttgtggctgctcctgctcctgaggatgtt
gctgctagcaaggatggtgagaaggaggccgaggaggccaaggccaagcctgccagcgag
aaccaggacgccaccgtcaaggatgagctgtaa

DBGET integrated database retrieval system