KEGG   Nectria haematococca: NECHADRAFT_36849Help
Entry
NECHADRAFT_36849  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 706 aa AA seqDB search
MSTVFPANALSQLGPPQTVADIAALTAVGVASAAYLLRGIAWDRPDPYDYIWYERMGSKD
GAASRPKATRDIAKKMEESGKDVVIFWGSQSGTAEMFANRLSKECHLRFGLQTLCADLCD
YDPDSIANLPQSKLAIFIISTYGEGDPSDNTAALWDWLNKRPFDIKLPNLRYMAFGLGNS
SYRYYNRVIDVVAEALDKAGAQRLMPVGKANDAQGGTEEDFLSWKDDLYTHFQEKLGYEE
RDIPYEPSIKIVEDESLDIMDLNLGEPVQNRSGPAKIVKQYSPIRPLTVQESRELYTSPG
RNCIHMELDLSDQAELRYRTGDHLAVYPINPDHEVQLLLKALGLEQRAETPLLIRALEEG
ESIKIPSPTSLLAVFRHYLEVSAPVSRETVGALARFAPSPEVANVLATLGKDKKAYAEFI
GKNHITLGRLLALAAPGAVWTNLPLTYVVETLPTIQPRYYSISSSSAVSARKVAITVGVD
NSPLQADATKAIRGVTTNYLYALGNSLNGDAAQPEVGPDAPTYALSGPGDTLKGHKVFAC
IRRSNFKLPTLGTTPLVMIGAGTGMAPFRGFILERARLKAVGKPIGRMILFFGCRSPDQD
YLYREELASVAKELDGLLEIVPAFSRSNSHSKSYVQDKVGEMKKDVCELLQGGANMYICG
RASMAREVGNVVEESMKQQNSWTDAEARSWAESAKKGSKWLEDVWG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtctttcctgcaaatgccctgtcccaactggggccaccccagactgtcgcc
gacattgctgcactgactgcagtcggcgtggcatcggccgcctatctcctccgtggcatc
gcatgggacagaccagacccgtacgattacatctggtacgaacgcatggggtccaaggat
ggtgcagcatcaagacccaaggcgacccgtgatattgccaagaagatggaagagagtggc
aaggatgtcgtcatcttctggggttcacagtccggcacagcagaaatgtttgccaacaga
ctctccaaggagtgtcaccttcgcttcggcctccagaccctctgcgccgacctttgcgac
tacgatccagactccattgccaacctcccccagagcaagctcgccatcttcattatctcc
acctatggcgagggagaccccagcgacaacaccgccgctctctgggactggctcaacaag
cgaccttttgatatcaagcttcccaacctccgttacatggcatttggtctgggaaacagc
agctaccgctactacaaccgtgtcatcgatgtcgtggctgaggcccttgacaaggccggc
gctcagcgtttaatgcccgtgggcaaggccaacgacgcccaaggcggcaccgaagaagat
ttcctctcgtggaaggatgatctctacacgcacttccaggagaagctcggctacgaggag
cgagacatcccctacgagcccagcatcaagatcgtcgaggacgagtccctcgacatcatg
gacctcaaccttggcgagcccgtccagaaccgcagcggccctgccaagatcgtcaagcag
tactcgcccattagacccctaacagtgcaggagtcgcgtgagctctacacgtcccccggc
aggaactgtatccacatggagctggacctcagtgaccaggctgagctccgctaccgaact
ggagaccacctcgctgtgtatcccatcaaccctgatcacgaggtgcagctccttctcaag
gcactgggacttgagcagcgagccgagacgcctcttctcatccgagccctggaggagggc
gagtccatcaagatccccagtcctacctcgttgctagctgtcttccgtcactacctcgaa
gtgtctgcccctgtctctcgtgagactgtcggtgccctcgctcgcttcgccccttcgcca
gaggttgccaacgttctggcaacccttggaaaggacaagaaagcctatgccgagttcatt
ggcaagaaccacatcactctaggccgtctcctggcactggctgctcctggtgctgtctgg
accaacctccccctgacctacgtcgtggagactcttcctacaatccagccccgatactac
tccatctcttcatccagcgccgtctccgcccgcaaggtcgccatcaccgtcggcgtcgac
aactcccccctccaagccgacgcaaccaaggccatccgtggcgttaccacaaactacctt
tatgccctcggaaactctctcaacggcgacgctgcccagccagaagttggccccgacgcc
cccacctacgctctctcgggccctggcgataccctcaagggccacaaggtctttgcttgc
attcgtcgctcaaacttcaagctccctacccttgggacaacccccctcgtcatgattggt
gccggcaccggcatggctcccttccgtggcttcatcctcgagcgtgctcgtctcaaggcc
gttggaaagcccattggtcgcatgatcctcttctttggctgccgctccccggaccaggac
tacctctatcgcgaggagctcgcctcagtagccaaggagctggacggcctccttgaaatc
gtccccgctttctcgaggtctaacagccactccaagtcctacgtacaggacaaggtcggc
gagatgaagaaggatgtatgtgagctgctccagggcggcgccaacatgtacatctgcggc
agggcgtcgatggctcgcgaggtgggcaacgtggttgaggagtcgatgaagcagcagaac
agctggaccgacgccgaggcccggagctgggctgagtctgccaagaagggcagcaagtgg
ctcgaggatgtctggggttaa

DBGET integrated database retrieval system