KEGG   Nectria haematococca: NECHADRAFT_37323Help
Entry
NECHADRAFT_37323  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
nhe  Nectria haematococca
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    NECHADRAFT_37323
  Amino acid metabolism
   00380 Tryptophan metabolism
    NECHADRAFT_37323
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NECHADRAFT_37323
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     NECHADRAFT_37323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1065 aa AA seqDB search
MAETVEIPTPAGLPLLGNIKSIDPEFPLGSMVSLAEQHGEIYRLKFPGRTVVIVSTQALV
NETCNEKRFKKCVNSALTEIREGVHDGLFTAKLGEENWGIAHRVLMPAFGPLSIQRMFDE
MHDIASQLALKWARYGPDSPIMVTDDFTRLTLDTLALCSMGYRFNSYYSPVLHPFIEAMG
DFLTEAGEKPRRLPLPGIVYRERDRKYQQDIETMRSTAKEVLDARKAGGSTRKDLLTAML
EGVDTKTGKKMTDESIMDNLITFLIAGHETTSGLLSFAFYQLLTHPEAYQLAQKEVDQVV
GKGPIQVGHLSKLPYLNGVLRETLRINATIPLFTVEAFEDTLLGGKYPVKAGETILNLLA
KSQLDPTVFGDDANEFKPERMFDDNFARLNKEFPNSWKPFGNGMRACIGRPFAWQEALLV
MVMLLQNFNFVLDPSYELGFKQTLTIKPKDMHMRAILRDNLTPTSLERRLAGLPVSEREE
ANGVNGKSSDAKDGVPMTVLYGSNSGTCESLAQRVATDAAEHGFHVTKIDCLDTANGNLP
TDQPVVIVTASYEGQPPDNAGHFVAWVEKADQETKPLEGVSYAVFGCGHKDWVQTFHRIP
KLVDSNLEQLGATRLVNIGLTDASENMVFSDFEAWEDNILWPALEARYNPESKKSSADKG
LSVKSSNFRTLTLRQDVKEATVVETKVLTSSTDTKSKKRHIEVELPEGTQYTAGDYLAVL
PINPQEVVRRALRRFKLPMDAHLEISSSTPTVLPTDTSVSALDVLSSYVELSQPATKRNL
LAIAEAASNEDTKAALTSLSEERYVEEISNKRVSVLELLERYPSVDLPIGDFLQMLPSIR
IRQYSISSSPLWNQSRATITFSVLKGPASSGQGIYNGVATSYLDSLADGDTLQVAIRSSP
AAFSLPSNPEQTPIICIAAGSGLAPFRGFIQQRAIMIESGRKLAPGLLFFGCRAPDQDDL
YHDEFDVWQKLGAVDVRRAYSRHGDGCKHVQDRIWQDKEDFIQLWEKGATVYVCGSRAVA
DSVREVMIKLKTEMEKRSGGEMGLEEAKKWFDEQRNVRYVMDVFD
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacagtcgagattccaacgcctgcgggcttgcctttgctaggcaacatcaaa
tctattgatcccgagttcccattggggtctatggtgtcgcttgctgagcagcatggcgag
atctaccgtttgaaattccctggacgaactgtcgtcatcgtctccacgcaagctttggtc
aatgagacgtgcaatgagaagcgcttcaagaagtgtgtcaattcagcactcactgaaatt
cgagaaggcgttcacgatggactctttactgcgaaacttggagaggagaactgggggatc
gcccacagagtgctcatgccagctttcggccccttgtcaattcagcgcatgtttgacgaa
atgcacgacattgcctcccaacttgctctcaagtgggcacgatacggacctgattctccc
atcatggtgacggatgactttactcgtctcactctcgacacactggctttgtgttccatg
ggctacagattcaacagctactactccccagttctgcacccctttatcgaagcgatgggt
gattttctcacagaggctggagaaaagcctcgacgactgcctttgcctggaatcgtctac
cgcgagcgcgaccggaagtatcagcaggatatcgaaaccatgagaagtaccgccaaggag
gttctcgacgcccgaaaagcagggggaagtacacgaaaggaccttttgacggcaatgctt
gagggcgtggacacgaaaaccggcaagaagatgaccgacgagagtatcatggacaacttg
atcaccttcctcattgctgggcacgaaaccacttccgggctgctttcgtttgctttctat
cagcttctcacacacccagaagcttaccagcttgctcagaaagaggtagatcaagtcgtc
ggcaaggggcccatccaagttggacacctctccaagctcccgtatctgaacggtgtcctg
cgagaaactctgcgcatcaacgccactatccccctctttacggtcgaggctttcgaagat
accctgcttggaggcaagtatcccgtcaaggctggagaaaccattctcaacctcctcgca
aaatcacaactcgatcctacggtctttggagacgatgcaaacgagttcaaaccagaacgg
atgtttgatgacaactttgccaggctgaacaaggagtttcccaactcatggaaacccttt
ggtaatggtatgcgagcctgcatcggaaggccttttgcctggcaggaagccctgctcgtc
atggttatgctcttgcaaaatttcaactttgttcttgatcctagctatgagcttggattc
aaacagacgttgactattaagccgaaggatatgcacatgcgagcgatcctgagagacaac
cttacgccgacgagtcttgagcgtcgtctggccggtttgcctgtttctgaaagggaagag
gcaaatggggtgaatggcaagtcttctgatgctaaggatggtgtccctatgacggtcttg
tacggatctaatagtggaacatgtgagtctttggcgcagagagtcgcaaccgacgctgca
gagcacgggttccacgtcaccaagatagactgtcttgacacggcaaatggaaatttgccc
acagatcagcctgttgtcatcgtcaccgcatcatacgagggccagcctcccgacaacgcc
gggcattttgttgcctgggttgagaaggctgatcaagagaccaagccactcgagggtgtc
tcatatgccgtctttggctgtggtcacaaggattgggtccagactttccatcgcattccc
aagctcgtggacagtaatcttgagcagcttggtgctactcgacttgtcaacattggtctt
accgatgcatctgagaatatggtcttcagcgactttgaggcatgggaggacaacattttg
tggcctgccctcgaggcgcgttacaaccccgagtccaagaagagttccgcagacaaggga
ttgagcgtcaagagctccaactttagaactctcaccctccgtcaggatgtcaaggaggcg
acagttgtcgaaaccaaggtcctcacaagcagcactgataccaagtccaagaagaggcat
atcgaagtagaactgcctgaaggcactcagtacacggccggagactaccttgccgttctg
cctatcaacccacaggaagttgttcgtcgggcattgaggagattcaagcttccaatggat
gctcatcttgagatctcgagcagtacgccgactgttctccccaccgacacgtctgtgtca
gcattagatgtgttgagctcctacgtggagctttcgcagccggccacgaaaaggaaccta
cttgccatagctgaggcggcgtctaatgaagacaccaaagctgctcttacctccctgtcc
gaggaaagatacgtcgaggagatcagcaacaagcgtgtatcagttctggaactccttgaa
cggtacccctccgttgatctacccatcggagacttcttgcagatgttgccatccattcgg
attcgccagtactccatctcctcatctccactatggaaccagtctcgcgcgacaatcacc
ttttccgtgctcaaggggccagcgtcatcaggccaaggcatctacaacggcgttgcaact
tcttatctcgactctctggctgacggcgacacgctacaagtggccattcgctcatcgcct
gctgcttttagcctcccatccaacccagaacagactccgatcatctgcattgcggctggg
tcaggacttgcaccgttcaggggtttcatccaacagcgagccatcatgatcgaatcaggt
cgtaagctcgccccgggtttgctcttcttcggctgtcgcgctcctgatcaagatgatctt
taccacgacgagttcgatgtatggcagaagctcggtgcggtagacgttcgacgagcgtac
agccgacacggagacggatgcaaacacgtccaagatcggatctggcaagacaaggaagac
tttatccaactctgggagaagggagctaccgtctatgtatgtggttcaagagcggtggct
gattcggtgagagaggttatgattaagttgaagacggagatggaaaagagatccggtggt
gagatgggcctggaggaggctaagaagtggtttgatgaacagaggaatgtgcggtatgta
atggacgtgtttgattag

DBGET integrated database retrieval system