KEGG   Nectria haematococca: NECHADRAFT_37515Help
Entry
NECHADRAFT_37515  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NECHADRAFT_37515
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NECHADRAFT_37515
Transcription machinery [BR:nhe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NECHADRAFT_37515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 434 aa AA seqDB search
MSARPTTPASPKNFKVKSPVPGSPMFGCDVDSRSGSLYCQICDDFVWDPTLEELRVRKIG
TGSFSGRKRKHDELFQDSIKDDPRYITNNTTTASCRANGLRGIYNAGATCYQNVVLQSFL
HNPLLRNFYLSDGHHDCQVSHCLSCAMDDMFQDFYALENTNGYTAANILSGFWISEKKAF
ENLVTTKEQDAHEFFQFLAEELHERNGDGKKPEIGSEHSCNCIMHQTFYGKMQTTTTCQN
CAGQSNSIQSFLDLSLGLENVVQKRIKKTGLKKPSLTLQDCLDEEYIKYDKCEYRCNNCS
SIQQAKRHTSIKRLPNVLSIQLKRFEYRHGRHDRAASKVSNEVRFPLQLNMLPYTNRARS
RDSRENFELERSCTYDLLSVVVHVGEIDTGHYTSYCRVGDQWFKFNDHKVEMASLSDVLG
AQAYLLFYIIRSLA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccggccgacaacacccgcgtcacctaagaacttcaaggtcaagtccccggtc
ccggggtcgccaatgttcggctgtgacgtcgactcccgaagtggctctctctactgtcag
atatgtgatgactttgtttgggatcccacattggaggagctccgagtgcgaaagatagga
accgggtctttctctggtcgcaagaggaagcatgatgagctcttccaggactccattaag
gatgaccctcgatacatcaccaacaataccacaaccgcctcttgccgcgcaaacggcctt
cgcggcatctacaacgctggtgccacttgctaccaaaacgttgtcctccaaagcttcctc
cacaatcccctcctccgtaacttttacctcagtgatggccaccacgactgccaggtttct
cactgcttgagctgtgccatggacgacatgttccaagatttctatgctctcgagaacacc
aacggctacacggccgccaacatcttgtcggggttctggatttctgagaagaaggccttt
gagaatctggtaaccaccaaagaacaagatgctcacgagttcttccagttcctggctgag
gaacttcacgagcgcaatggcgatggcaagaagcccgagattggcagcgaacacagctgc
aactgcatcatgcaccagaccttttacggcaagatgcaaaccacaaccacatgccagaac
tgcgctggacagagcaattccatccaatccttcctagatctaagccttggtctcgagaat
gtggttcagaaacgaatcaagaagacgggtctcaagaagccatcccttactctacaagac
tgcctggacgaagagtacatcaagtatgacaagtgcgagtatcgctgtaacaactgtagc
tcgatccagcaagccaagcgacacaccagcatcaagcgtttgccgaatgttctatcaata
caactaaagcgcttcgaatataggcatggaagacacgacagggcagcctccaaggtcagc
aacgaggtgcgattcccgctgcagctgaacatgctgccctacacgaatcgtgcccgtagc
cgtgacagtcgcgaaaatttcgagttagaacgatcatgcacctacgatctcctcagtgtt
gtggtccatgtcggcgagatcgatactggccactacacatcgtactgccgggttggtgat
cagtggttcaagttcaacgaccacaaggttgagatggctagtttgtctgatgtactcggc
gctcaagcctatctgctcttctacatcatccgttccctcgcttaa

DBGET integrated database retrieval system