KEGG   Nectria haematococca: NECHADRAFT_37766Help
Entry
NECHADRAFT_37766  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nhe  Nectria haematococca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nhe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 313 aa AA seqDB search
MTSSSKVPVLLLKTRSSPGDSYEDLFSETSAAGASFAPQFVPVLLHQFQDEGMKKVAEVL
REGRIGNKEHHEYGGLIFTSQRAVEAFVKLVQDGKDENDSIKNDPPTSWPHLQHIPVYSV
GPATTRALAAVPQDPPLSVFGSHTGNGATLAPYILSHYREWHAGRPSLPPVLFLVGETRR
DIIPKTLQDPGLPDGERIAVDETVVYGTGVMESFPIDLDRVLSETQDAPARWVVVFSPTG
CDSLLQVMGVLDPETGKVREGSVRDGKTYVATIGPTTRDHLKSFGFEPDVCAESPTPQGV
LDGIQEFMTRNQS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttccagcaaggtgccggtcctcctgctcaagacgaggtcgagtcccggtgat
tcatacgaggaccttttctccgagacgagcgccgctggagcttcctttgcgccgcagttt
gttcccgtgctgttgcaccaattccaagatgagggcatgaaaaaggttgcagaggtgctc
cgcgagggacggattggaaacaaggagcatcatgagtatggcggcttgatctttacttca
cagcgcgcggttgaggcgtttgtgaagttggtgcaggacggcaaggatgagaatgacagc
atcaaaaatgaccccccgacgtcgtggcctcacctccagcacattcccgtctacagcgtc
ggccccgcgacgacccgcgccctcgccgccgtcccgcaggatcctcccctgagcgtcttc
ggtagccacacgggcaacggcgcgaccctcgccccttatatcctctctcactaccgcgaa
tggcacgccggccggccgtcgttgcctcccgtgctgtttctcgttggcgagactcgacgg
gacattattcccaagacgttgcaggaccctgggctgccggacggcgagcgcatcgcagtt
gacgagacggtcgtttacggaacgggcgtcatggagagcttccccatcgacctggatcgc
gtgctttctgagacacaggatgcgcctgcacgttgggtggtagtattctcgccgacgggg
tgcgatagcctactccaagttatgggcgtgctggacccggagacgggcaaggtgcgtgag
gggagcgtgcgggatggcaagacgtatgtcgcgacgattgggcctacaacaagagatcac
ctcaagtcgtttggctttgagcccgacgtgtgtgccgagtcaccgacgccgcagggcgta
ttagacgggatccaagagtttatgactaggaatcaaagttga

DBGET integrated database retrieval system