KEGG   Nectria haematococca: NECHADRAFT_38413Help
Entry
NECHADRAFT_38413  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NECHADRAFT_38413
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NECHADRAFT_38413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 1585 aa AA seqDB search
SPSPDSVLPSCEVDDDPALSFSAASVASRPDTPSYLRADSQPASSLPPRLQQQTSSLVSA
DYASSTASSPCASAYADLSLESDRGGEETGPAQSTARSQSPLRLSHRAIMNGDADLPHRS
SSPLKRRASSMDPENEADKPRDVDMASSQPADSTEGPSQPSTSTLPRAMSVDPSEPTPST
ADAASSQPMPPLKEQVQIIETLLKAFDEEPIKEGAKAYLVSNTWVKKALALRGDTKESKD
GTPEALGPVDNSDIIQEVLKDPSGGNFTLLKPGFGLDEFTLFPEDAWKMVVEWYGVKEGQ
EAIVRTAINTAAPGDESNILYEFHPPLFTVHRLWSQVSPLPIEQSLKANNPPPLRISRSR
KYHAQTFIKELKTATGVPLDRKIRLFMVPQIQQEAGPSEPSRALTPPDSPDRADEEPNPA
DSWSKLLLDTPSFAEVRDLKVKSTLEDRTTDPNYNGKTTLAIFDLVTDQTLVIDEAIDKS
WVSTYTGQGRANEKSIPTRGSGLASSNASGRSSPALGGPLTRGRMGKKSGRSVGAVGLQN
LGNTCYMNSALQCVRSVEELTKYFLTDDYVDEVNKTNPLGYNGKVAMTYGNLLKEIYTEG
RSSVVPRDFKTTIGRCRPTFSGWGQQDSQEFLGFLLDGLQEDLSRVKKKPYIEKPDSTDD
MINNPAAIKEMADQVWDITRRRDDSVIADLFTGMYKSTLKCPECGKISITFDPFNNLTLP
LPVEDVWHGTVTFLPLSDAPVSIEVELPKHSAIEQLKQFVSIRTGVPPERLMGGEEFKDR
FFKIYDNTQDVSEEIGKSDIVTFHELEAVPTNWPHKARTKKYRSMLDVDTPLETVSWDDP
RYEQMVVPVFHRIATSSSGRGRDSASPPSFICLTKEDASNIDIITRKVLEKIATFSTWSK
LKDTQEESSDNADGEIVLTSASDADSSGDSKVVATSVEGEDDLVDVHMKDSTDANAPLPH
QPQVLRRFNSKRPKFVNPDGFLDPELQNLFDLSYFVDTAADGGVPTGWSHVDPHRLLPKL
TDRIPEPVVDDDDAASVEADSSTASGPDDDSTNDESHKAETSQTRMVDDSSEEEEVQKPA
RAFNGRPSKVAGRRKKFNKNNKTYGKKGNKRRDKQMRTDKKHKLQTVKSQPTPPAVADGG
PLIRLGEGLVVNWNEDAWLKVFGGSPNSPFDDQGVATFTNPETLNDPALKISQRRRNNRR
TRGITLEECLDEFERAEILSEQDMWYCPRCKEHRRASKKFDLWKSPDILVAHLKRFSSSG
YRRDKLDVLVDFPIEGLDLTSRVIQKEEGKDEIYDLIAVDDHYGGLGGGHYTAYAKNFVD
GRWYNYNDSSVSPVSDPSACITSAAYLLFYRRRSSIPLGGSRFGVISEKYRTSEENSEED
DELGEGQRLGEGSSLIGSSSAGTGAAAIRRRGDRGSGSVAVKALAGPDDDDDPPPYEGAN
RIETIHDSIEDEGVDVKDSYQQLGTSKSISLTQTWNFEGLAGSGAEDSTVADIASDEVQL
DSSSDERGLSQFDDPDTLMTGHDLADEQLEPLVPDDSHQGSLADIQNATWERKGVIAVPT
GAGSDGDSNEVAEIHLENEKGTRTG
NT seq 4758 nt NT seq  +upstreamnt  +downstreamnt
tcgccctcccccgactcggtcctgccctcgtgcgaagtcgacgacgatcccgccctctcc
ttctccgccgcctctgtggcctcgcgccccgacactccctcttacctccgggctgactcc
cagcccgcctcgagcctgcccccgcgcctccagcagcagaccagttccctcgtctctgcc
gactacgcctcgtccaccgcctcgagcccttgtgcctctgcatacgccgatctctctctc
gaaagcgaccgtggcggcgaagagactggcccggcccaatccacggccagaagccagtct
cccttgcgtctctcccatcgtgctattatgaatggcgatgcggacctgcctcaccgttct
tcatcgcctttgaaacgacgcgcttccagcatggatccagaaaacgaagcggataagccc
cgcgacgtcgacatggcttcctcccagcccgctgactctaccgaggggccttctcaacca
tccaccagcaccctaccccgagccatgagcgttgacccctcagaacctacaccatcaacc
gctgatgctgcctcctcacaaccgatgcccccgttgaaggagcaggttcagataatcgag
actcttctaaaggcctttgacgaagagcctatcaaggaaggcgccaaggcgtatctcgtt
tccaacacctgggtcaagaaggcgctcgcgctacgtggagacaccaaggagagcaaggat
ggcacacccgaggccctgggccctgtggacaattcagacattatccaagaagtgctcaag
gatcccagtggcggcaacttcaccctcctcaaaccaggattcggccttgacgagtttact
ctcttccctgaagatgcttggaagatggtggttgagtggtatggggtcaaggaaggccaa
gaagccatcgttcgcactgctatcaacactgcggcccctggcgacgaatctaatattctt
tacgagttccacccaccgctcttcaccgttcaccgactctggtcccaggtcagcccgtta
ccaattgagcagtccctcaaagccaacaatcctccgccgctgagaatctccagaagccgc
aagtaccatgcgcaaaccttcatcaaggaactcaagacagcgactggcgttcctcttgat
cgcaagatccgcctgttcatggtccctcaaatccagcaggaagcgggcccctcggaaccc
tcccgagctctcacgcctcccgattctccagaccgagcagatgaggagccgaaccctgcc
gactcgtggtcaaagctgcttcttgataccccatcctttgcagaggttcgagatctcaag
gtgaagtctactttggaggatagaaccaccgatccaaattataacggcaagacgacgcta
gcaatcttcgacctcgtcacggaccaaacgcttgtcattgatgaagcgatcgacaagtcg
tgggtcagcacatatactggacaaggccgcgccaacgaaaagtccatccccacgcggggc
agcggattagcctcgtccaacgcaagtggccggagtagccctgcgcttggtggtcctctg
actcggggccgaatgggcaagaagtccggacgcagtgtgggcgcagttggtcttcagaac
cttggaaatacctgttacatgaactctgcgttgcagtgtgttcgaagcgtcgaagaattg
accaagtactttttgaccgacgactacgttgatgaggtcaacaaaaccaatcctctgggg
tacaacggaaaggttgctatgacgtatggaaacctactgaaggagatttacacagaaggc
agaagctcggtggttccgcgagacttcaagacaactatcggtcgttgccggccaacgttc
tctggctggggccagcaagattctcaggagttccttggtttcctgctggatggtctccag
gaggaccttagccgtgtcaagaagaagccctacatcgaaaagccggactcaacagacgac
atgattaacaacccggccgctatcaaggagatggccgaccaggtttgggatattactcga
cgccgagacgactccgtcatcgccgacctcttcactggaatgtacaagtcgactctgaag
tgccctgaatgcggcaagattagcatcacattcgatcccttcaacaacctgacccttccg
ctgcccgttgaggatgtgtggcacggcacggtcacgttcctgcccctgagcgatgccccc
gtttcaatcgaggttgagttgcccaagcatagcgctatcgagcagctcaagcagttcgtc
tcaatccggaccggtgttcccccagagcgcctgatgggtggcgaagaattcaaagatcgg
ttcttcaagatctatgataacacccaggatgtgagtgaggagatcggtaagtccgatatc
gtcacattccacgagctggaagctgtcccgacaaactggcctcacaaggcacgaactaag
aaatatcgttccatgctggatgtcgatactcctctcgagactgtttcatgggatgaccca
cgatacgagcagatggtggtgccagtattccatagaatagcgacatcgtccagcggccgt
ggccgagatagtgcttcaccacccagcttcatctgcttgaccaaggaagacgcatccaac
atcgacatcattacacgaaaggttctggagaagattgctaccttttcaacttggtccaaa
ctcaaggatactcaggaagagagttcggataatgctgatggagaaatcgtcctcacctcc
gcctcagatgctgattcttcaggcgatagtaaggttgttgccacttctgtggagggcgag
gacgacttggtggatgtgcacatgaaggattcgaccgatgccaacgcccctcttcctcat
cagccccaggtcctgagacgtttcaactcgaagcgacccaaatttgtcaacccagatggc
ttcctggaccccgagctccaaaatcttttcgacctgagctactttgtagataccgcagcg
gacggtggtgtgccgactggctggtcacatgttgacccccataggcttctgcccaagctc
acggatcgtatccctgagccggttgttgacgatgacgatgctgccagtgtggaggccgat
agcagcacagcatcgggtcctgatgacgatagcaccaacgacgagagccacaaggctgag
acgtcacagactcgaatggtggatgattcaagcgaggaggaggaggtgcagaagcctgcc
cgagcgttcaatggacgtccttcaaaggtggctggccgacgtaagaagttcaacaagaat
aacaagacgtatggcaagaagggcaacaagcggcgagacaagcagatgcgtaccgataag
aaacacaagctacagactgtcaagtctcagcctacgcctccagctgtggctgatggcggc
cccttgatccgcctgggcgagggtctcgttgttaactggaacgaggacgcttggctcaag
gtgtttggtggctctccaaacagtcctttcgatgatcaaggagtggcaacgttcaccaac
ccagagactctcaatgaccctgctcttaagattagccagagacggaggaacaatcgtcgc
actcgaggtatcactctcgaagaatgccttgatgagttcgagagggccgagatcctctct
gagcaggacatgtggtactgtcctcgctgcaaggagcaccgccgagcgagcaagaagttt
gatctttggaagtcgcccgatatccttgtagcccacctcaaacgattcagcagctctggg
taccggcgagataagctggatgtgctagtcgacttccctatcgagggtcttgacctcacc
tcacgcgtcattcaaaaggaggagggcaaggacgagatctacgacttgattgccgtcgat
gaccactacggcggacttggcggaggccactacactgcctatgccaagaactttgttgat
ggacgttggtataattacaatgattcatccgtcagcccagtatcggacccctcagcctgc
atcacgtcagctgcgtatcttctcttctaccgccgccgttcaagcatccctttaggcgga
tctcggttcggagtcatctctgagaagtaccgaaccagcgaagagaactcggaagaagat
gacgagttgggggaaggtcagcgcctcggcgagggttcctccctgattgggtcgtcgagc
gctgggaccggagccgcagcaattcgccgtcggggcgatcgtggatcgggtagtgtcgct
gtgaaggcactggctggcccagatgacgacgacgatcctcctccctacgagggcgccaat
cgtatcgagaccatccatgacagtatcgaggacgagggtgtagacgtgaaggatagttac
cagcaactcggcacttccaagtctatcagccttactcagacctggaactttgagggcttg
gccggcagcggcgccgaggattctacggttgcagatattgcctcagatgaagttcaactg
gactcatcatcagatgagcggggtctgagccagttcgatgaccccgatacattgatgact
ggtcacgatcttgcagacgaacaattggagccgctggtccccgatgacagccaccagggg
tctctggcagacatccagaacgcaacttgggagcgcaagggggttatcgcggtgcctact
ggagcaggcagtgatggggactcgaacgaagtggctgagatccatctcgagaacgagaaa
ggaactcggaccgggtag

DBGET integrated database retrieval system