KEGG   Nectria haematococca: NECHADRAFT_40231Help
Entry
NECHADRAFT_40231  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NECHADRAFT_40231
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NECHADRAFT_40231
Peptidases [BR:nhe01002]
 Metallo Peptidases
  Family M67
   NECHADRAFT_40231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 469 aa AA seqDB search
MESMRPARPQTVKELVAQAENFNFNANIPVKHWTRAAETLYKEAGFAVSDGDYGRAYMML
YRHSVLVLQYLPSHPQIKDPENKKAFSALSKRIGRVIQDLEQLKPEIENAVKEWERMAPP
PQAANKTSEPSRYEEFAARDPSLTGNAKILDAFENQDLAVDLAQKELIRRDTARRATRKA
GISDEDIMSRRMGGRWDQWDGDDLRQQMEATRQALDSARERRNDEDFRTAPVSQSYNYPS
ISKSRPVDYERSITPTTPSIQPSRPPKEPISLPPKEPLYPTSGSGTLPPSLPQKVPLSQY
APLLPSPQPTTADRPQVPRKEAISPPPTLPKKERLTFKPGAYLENGDPIRSLFIPRQLRQ
QFLNIASENTRRGLEMCGMLCGTPINNALFVRCLLIPDQKCTSDTCETENEESMFDYCMK
EDLLLLGWIHTHPTQTCFMSSRDLHTHAGYQVMMPESVAIVCAPKFTPS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgatgcggcctgctcggccccagacggtcaaggagctggtggctcaggctgag
aacttcaactttaacgcgaatattcctgtcaagcactggacgcgcgccgctgagacatta
tataaagaggccgggtttgcagtctccgatggcgattatggacgagcatacatgatgctc
taccgacactcggtcctcgtcctccagtaccttccctcgcacccgcagatcaaggatccc
gagaataaaaaggcattttctgccttgtcgaagcgtatcggacgtgtgattcaggacctc
gaacaactgaaacccgaaatcgagaatgctgtcaaggaatgggagcggatggcgcctccg
ccccaggcggcgaataagacgtcggaaccttcgagatatgaagagtttgcggcccgagac
ccaagcttaaccggaaacgccaagatcctagatgcctttgagaaccaagacctggctgtt
gacctggcccagaaggagctgattcgaagagacacggcaaggcgagcgacaaggaaggct
ggtatctcggatgaggatatcatgtctcgaaggatgggagggagatgggatcagtgggat
ggcgatgatctgcgacaacaaatggaggcgacgaggcaggcactcgattcggctcgtgag
cgacgtaatgatgaggatttccggacagcgccggtatcgcagtcgtacaactatccgtcc
atctcaaagtcgaggccggtggattatgagaggtcaataacaccgacaacaccttcgatc
cagccgagtcgaccgccaaaggaacccatatctctaccacccaaggaaccgttgtatcct
acatcgggatctggaactcttccaccgagtctgcctcaaaaggtccccctctctcaatac
gcccccctcctcccatctcctcaacccacaacggccgaccgaccccaagtgcctcgaaag
gaggccatcagcccgccgccaacgcttcctaagaaggagcgtctgacgttcaagccgggc
gcatatctggagaatggcgatcctatacgctcactgttcattcccagacaactccgtcag
cagttcctcaatatcgcgtctgagaacacgcgccgagggctcgaaatgtgtgggatgctc
tgcggaactcccatcaataacgccctttttgttcgatgtcttttgatccccgaccaaaaa
tgcacttcggatacttgcgagacggagaacgaagagtccatgtttgactactgtatgaag
gaagacctactgctgctgggatggatccacacgcacccgacacagacgtgcttcatgagc
tctcgagacctgcacacgcatgctggatatcaggtcatgatgcctgagagtgtggccatt
gtttgcgcacccaaattcacgccctcgtaa

DBGET integrated database retrieval system